KEGG   Mus musculus (mouse): 68327
Entry
68327             CDS       T01002                                 

Gene name
Tsr3, 0610007P22Rik, 1110014B11Rik, AL022759
Definition
(RefSeq) TSR3 20S rRNA accumulation
  KO
K09140  pre-rRNA-processing protein TSR3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    68327 (Tsr3)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    68327 (Tsr3)
Motif
Pfam: Ribo_biogen_C RLI
Other DBs
NCBI-GeneID: 68327
NCBI-ProteinID: NP_080952
MGI: 1915577
Ensembl: ENSMUSG00000015126
UniProt: Q5HZH2
Position
17; 17 A3.3
AA seq 323 aa
MGRKKVARGSRKESGRVRRPSGRSLDAFAEEVGAALRASVQPEEAEDQGGPGPAALPCAL
AMWELGHCDPKRCTGRKLARLGLVRCLRLSQRFGGLVLSPVGTEYVSPADRQLVAQSGVA
VIDCSWAKLDDTPFQKMRGSHLRLLPYLVAANPVNYGRPCKLSCVEAFAAAFCIVGFSDL
AVILLRKFKWGKGFLDLNRELLDKYAACRGPEEVLQAEQGYLASTRDTPEEDIDPFDVDS
GREFVNLNRPVASTRLPEDMDDTDGSEEHSEDSEEDSDECEEPGPGANGGDSNYSGAEET
PEQEAQARDSTEIWKGIKKRQRD
NT seq 972 nt   +upstreamnt  +downstreamnt
atgggccgcaagaaagttgctcgcggatccaggaaagagagcggtcgtgttcggcgaccc
tctggccgctctctggatgctttcgctgaagaggtgggcgctgcgctgcgtgcatccgtg
cagcccgaggaggccgaggaccagggcggcccgggccctgcggcgctgccttgtgccttg
gctatgtgggagcttggtcactgcgaccccaagcgctgcacgggccgcaaactggcccgt
ctgggtctggtgcgctgcctgcgcctgagccaaaggtttggcggtctggtgctcagccca
gtaggcactgagtacgtgtctccggcagacagacagctggtggcacagtcaggggtcgca
gtcatagactgctcctgggccaaactggacgacacaccctttcagaagatgcgagggagc
cacttgcggctcctgccttacctcgtagctgccaaccctgtaaactatggccggccctgc
aaactttcctgtgtggaagctttcgctgctgccttctgcatcgtaggcttttcagacctt
gctgtcattttgcttcggaagtttaagtggggcaagggcttcctggacctgaaccgggag
ctcctggataagtacgcagcttgccgtggcccggaggaggtgttgcaggctgaacagggg
tacttggctagcaccagggacacgcctgaagaggacatcgatccctttgacgtggactca
gggcgggagtttgtgaatctcaacaggcccgtggccagcacccggctacctgaggacatg
gatgacactgatgggtctgaggagcacagtgaagattctgaggaggacagtgatgagtgt
gaggaaccaggacctggtgctaatggaggagacagcaactactctggagctgaagagacc
ccagaacaagaggctcaagccagagactccactgaaatttggaaagggatcaagaaacga
cagagagactga

DBGET integrated database retrieval system