KEGG   Mus musculus (mouse): 68328Help
Entry
68328             CDS       T01002                                 

Gene name
Rab13, 0610007N03Rik, B230212B15Rik
Definition
(RefSeq) RAB13, member RAS oncogene family
  KO
K06109  Ras-related protein Rab-13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    68328 (Rab13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    68328 (Rab13)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    68328 (Rab13)
   04031 GTP-binding proteins [BR:mmu04031]
    68328 (Rab13)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    68328 (Rab13)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   68328 (Rab13)
  Exosomal proteins of colorectal cancer cells
   68328 (Rab13)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    68328 (Rab13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 RsgA_GTPase PduV-EutP AAA_7 AAA_22 Septin AAA AAA_16 TniB AAA_33
Motif
Other DBs
NCBI-GeneID: 68328
NCBI-ProteinID: NP_080953
MGI: 1927232
Ensembl: ENSMUSG00000027935
Vega: OTTMUSG00000021948
UniProt: Q9DD03
Position
3 F1; 3 39.21 cM
AA seq 202 aa AA seqDB search
MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVDIEGKRIKLQ
VWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLG
NKCDMEAKRQVQREQAEKLAREHRIRFFETSAKSSVNVDEAFSSLARDILLKTGGRRSGT
NSKPSSTGLKTSDKKKNKCLLG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcctacgaccacctcttcaagttgctgctcatcggggactcgggggtgggc
aagacttgtctgatcattcgctttgcagaggacaacttcaacagcacttacatctctacc
atcggaattgatttcaagatccgaaccgtggacatagaggggaagaggatcaaactgcaa
gtgtgggacacggctggccaagaacgattcaagacaataactaccgcctattaccgtgga
gccatgggcattatcctcgtatatgacatcacagatgagaaatccttcgagaatattcag
aactggatgaaaagcatcaaagagaatgcctctgcgggagtggagcgcctcctgctggga
aacaagtgtgacatggaggccaagcggcaggtgcagagagagcaggcggagaagttggct
cgagagcacagaatccgattttttgagacgagtgccaaatccagtgtgaatgtggatgag
gctttcagttccctggcccgtgacatcttgctcaagacaggaggccggagatcgggaacc
aacagtaagccctcaagcactggcctgaaaacatctgacaagaagaagaacaagtgcttg
ttaggctga

DBGET integrated database retrieval system