KEGG   Mus musculus (mouse): 68339
Entry
68339             CDS       T01002                                 

Symbol
Ccdc88c, 0610010D24Rik, AV000935, AW324073, Da, Daple, mKIAA1509
Name
(RefSeq) coiled-coil domain containing 88C
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: HOOK_N
Other DBs
NCBI-GeneID: 68339
NCBI-ProteinID: NP_080957
MGI: 1915589
Ensembl: ENSMUSG00000021182
UniProt: Q6VGS5
Position
12; 12 E
AA seq 2009 aa
MDVTVSQLVELFLQSPLVTWVKTFGSFGSGHQDNLTLYMDLVDGIFLNQIMLQIDPRPSN
QRINKHVNNDVNLRIQNLSILVRNIKTYYQEVLQQLIVMNLPNVLMIGKDPLSGKSMEEI
KKVLLLVLGCAVQCERKEEFIERIKQLDIETQAGIVAHIQEVTHNQENVFDLQWLDLPDV
APEELEALSRNMVFHLRRLIDERDECTELIVDLTQERDYLQTQQPPSPGKFSSPDSTPSP
TSSLSSEDKQHLAVELADTKARLRRVRQELEEKTEQLADTRHEVDQLVLELQKAKQDNIQ
LAADARSARAYRDELDSLREKANRVERLEMDLVRCKEKLHDVDFYKARMEELREDNIILI
ETKAMLEEQLTASRARSDKVHELEKENLQLKSKLHDLELDRDADKKQIEKLLEEYMVLEM
AQKQSMKESAHLGWELEQLSKNADLSDASRKSFVFELNECASSRILKLEKENQSLQSTIQ
GLRDTSLALEESSLKYGELEKENQQLSKKIEKLQTQLEREKQSNQDLETLSEELIREKEQ
LQSGMEALKADRARQIKDLEQEKGHLHQAVWSLRERPQVNSTKDVEKENRALHQAVTEAG
SKLSQLELEKQQLHRDLEEAKEKGEQAEALEKELHRLEKENEQLTKEVTSLKAATEKVEA
LEHQSQGLELENRSLRKSLDTLQNVSVQLEGLERDKQQLGQENLELRKMVEAMRFTSAKM
AQIETENRQLEREKEELRRDVELLKTLSKKSERLELSYQSVSAENLQLQHSLESSTHKSQ
ALQRELSQLEAERQALRRDLETLQLTHKQLEGAEEDRKALEQEVAQLEKDKKLLEKEARR
LWQQVELKDAILDDSAAKLSAAEKESRALDKELARCRDVGSKLKELEKDNRDLTKQVTMH
TRTLTTLREDLVLEKLKSQQLSSELDKLSQELEKVGLSKDLLLQEDDGHGDGKGKTESAL
KTTLAMKEEKIVFLEAQVEEKESLSRQLQIELQMIKKEHEQLRQTQEGGDKAQNALKRPP
GKVTSHQEKEAWEPSHKEATMELLRVKDRAIELERSNAALQAERQLLKEQLQHLETQNVS
FSSQILTLQKQSAFLQEHTTTLQTQTAKLQVENSTLSSQNAALSAQYTVLQSQQAAKEAE
HEGLQQQQEQLAAVYEALLQDHKHLGTLYECQSSEYEALIRQHSCLKTLHRNLELEHKEL
GERHGDLQQRKAELEELEKVLSTEREALEREQKTNAIATSENQRLRGELDRISFLHQQLK
GEYEELHAHTKELKTSLNNSQLELSRWQVRFDELKEQHQSMDISLTKMDNHCELLSRLKG
NLEEENHHLLSQIQLLSQQNQMLLEQNMESKEQYHEEQKQYIDKLNALRRHKEKLEEKIM
DQYKFYDPAPKKKNHWIGAKALVKLIKPKKEGSRERLKSTTDSPPWQLEPSDPASPSPSQ
ALRSQTENPDNPPSGPNCVEERDTHNGPVGKGPGDLKPKRGSPRGGSVDRTDTSTDPAVK
SWPSEPGSRTFSTSATTAALSSSTPIPKHLGRTKGCNSDDNLCEPSSEPDGPYHRQQASR
PNSLESSRNASSNSSPLSLKGSSDHLHSRCESFSSADLIPSRDPATLSRDGNTSGRGLLG
RHEYPPPRNGPVSQETIQKKGAASTHTGVRPHSASPSSEMVTLEEFLEESNRGGSPTHDT
PSCRDDLLSDYFRKAHDPPALGGQPGPPARKDGAKMPTSFVAPTIKMSINTSEGQQLKPG
HYVKPNLRPSEAEALAGMPSRQVQPPQSLSLGRPRQTTMTQNCHMPVSRSASLSRAFSLA
SADLLRASGPEACRPESPQKPGGHEAAGARETSTHSLQGSHILARERTPIVGKADSPSPG
QGTRGRPLDTRRFSLAPPKEERLAPLQQSATAPALATGCSSGSNPQIQHFSPTVAPAVRT
KSKVPQHSGEVATVAPVRPGLGTSEGDGGPGHGYSEGLLTKSPGRSSDLPPHVKRGPDDF
SQGSSSKSTPASPEPGGDPQTVWYEYGCV
NT seq 6030 nt   +upstreamnt  +downstreamnt
atggacgtgacggtgtcgcagctcgttgagctgtttctgcagagccctctggtgacctgg
gtgaaaacttttggatcgtttggaagcggccaccaggacaacttgactctgtacatggat
ttagtggacggcatctttttgaatcaaatcatgctgcaaatagaccccaggcccagcaat
cagcgcatcaacaagcatgtcaacaatgatgtcaacctgcgcatccaaaacctgagtatc
ctggtgagaaacatcaagacctactaccaggaagttctccagcagctgatcgtaatgaat
ttgcccaatgtcttgatgattggcaaagacccgctgtctgggaagagcatggaggagatt
aagaaggtcctgctgctggtgctgggctgtgccgttcagtgtgagaggaaggaggagttc
attgagagaatcaaacagctggacatcgagacccaggctggcattgtggctcatatccag
gaggtgacccacaaccaggagaatgtgtttgacctgcagtggctggacttgccagatgtg
gccccagaggagctggaggccctctccagaaacatggtgttccacctccgcagactcatt
gacgagcgtgacgagtgtaccgagctgatcgtggacctgacacaagagagggactacctc
cagacacagcagcctcccagccccggcaagttctccagcccagactccacaccaagcccc
accagcagcctgtccagtgaagacaagcagcacctagccgtggagctggctgacaccaag
gccaggctgcggcgtgtcaggcaggagctggaggagaagacggagcagcttgcagacacc
aggcacgaggtggatcagctggtcctggagcttcagaaggccaagcaagataatattcag
cttgcagctgatgcgcggtcagcccgggcctatcgggatgagctggactcgctgagggaa
aaggcgaaccgtgtagagaggctggagatggatctggtacgctgcaaggagaagctgcac
gacgtggacttctacaaggctcgcatggaggagctgagggaagacaatatcatcttaatc
gagaccaaagccatgttggaggaacaactgactgcctcccgggctcgcagtgataaagtc
cacgagctggagaaagagaacctacagctaaaatctaaactccatgacttggaactggat
cgggatgcagacaagaaacaaattgagaagctgctggaagaatacatggttctggagatg
gctcagaagcagagcatgaaagagtcggcccaccttggctgggaactggagcagctgtcc
aagaacgcagacttgtccgacgcctccaggaaatccttcgtctttgagctgaatgagtgc
gcctccagccgcatcctgaagctggagaaggagaaccaaagcctacagagcaccatccag
ggtctgcgggacacgtcgctggcgctggaggagagcagcctcaagtatggggagctggag
aaggagaaccagcagcttagcaagaagattgaaaagttacaaacgcagctggagagagaa
aagcagagtaaccaagacctggagacgctgagtgaggagctgatccgagagaaggaacag
ctacagagtggcatggaggccctgaaggcggacagggccaggcagataaaggatctggaa
caggagaagggccacctccaccaggctgtgtggtccctgcgggagaggccgcaggtcaac
agcacgaaggatgtggagaaggagaacagagccctccaccaggctgtgacagaggcgggc
agcaagctcagccagctggagttggagaagcagcagctgcacagagacttggaggaggcc
aaggagaagggagagcaggcggaggcgctggagaaggagctgcaccggctggagaaggag
aatgagcagctgaccaaggaggtgacctccctgaaggcagccactgagaaggtcgaggcc
ctggagcatcagagccagggtctggagctggagaaccgctcgctgagaaagtccctggac
accctgcagaacgtgtctgtgcagctcgagggcctggagagggacaagcagcagctgggt
caggagaacctagagctgcgcaagatggtggaggccatgcgcttcaccagcgccaagatg
gcgcagattgagacggagaaccggcagctggagagggagaaggaggagctgcgcagggac
gtggagctgctcaagaccttgagcaagaagtcggagcggctggagctcagctaccagagc
gtgagcgccgagaacctgcagctgcagcacagcttggagagcagcacccacaagtctcag
gcgctgcagagggagctgagccagctggaggccgagcgccaggccctgaggcgagaccta
gagactctccagctcacccacaagcagctggagggggccgaggaggacaggaaggccctg
gagcaggaggtggcccagctggagaaggacaagaaactgctagagaaggaggccagacgc
ctgtggcagcaggtggagcttaaggacgccatcctggatgacagcgctgccaagctgtcg
gcggccgagaaggagagccgtgcgctggacaaggagctggcccgctgccgggacgtgggc
agcaagctgaaggagctggagaaggacaacagggacctcaccaagcaagtcaccatgcac
acgaggacgctgaccaccctgagagaggacctggtgctggagaagttgaagagccagcag
ctaagcagcgagctggacaagctgagccaggagctggagaaggtcggcctcagcaaggac
ctgttgctgcaggaggatgacggtcacggtgacggaaaaggcaaaaccgaatcagccttg
aaaacaacactggctatgaaagaagaaaagattgtgtttttggaggcacaggtggaagag
aaagagagcttgagtcgccaactccagattgagctgcagatgataaagaaagaacatgag
cagctgaggcagacccaagagggtggagacaaggcacagaacgcactgaagcgccctccg
ggcaaggtcaccagtcaccaagagaaggaggcctgggagcccagccataaagaggccacc
atggagctactccgtgtgaaggaccgggccatcgagctggagcgcagtaacgcagctctt
caggccgagaggcagctgctgaaggagcaactacagcacttggagactcagaacgtgtcc
ttcagcagccagatcctgaccctacagaagcagagcgccttcctgcaagagcacaccacc
acgctgcagacccagactgcgaagctgcaggtggagaattccacactgagttcccagaac
gcagcgctcagtgcacagtacacggtgttgcagagccagcaggctgccaaggaggccgag
cacgagggtctgcagcagcagcaggagcagctggcagccgtctatgaagccctgctgcag
gaccacaagcacctgggcaccctgtacgagtgccagtcctcagagtatgaggccctcatc
cgccagcacagctgcctgaagacgctgcacaggaacctggagctggagcacaaggagctg
ggggagaggcacggagacttacagcagcgtaaggcagagctggaggagctggagaaagta
ctgagcaccgagcgggaggcacttgagcgggagcagaagaccaacgccattgccacgagc
gagaaccagaggcttcgaggagagctggacaggatcagcttcctgcaccagcagctgaaa
ggggagtatgaagagctgcacgcccacaccaaggagttgaaaacctcgctcaacaactct
cagctggagctgagccgctggcaggtgcgcttcgacgagcttaaggagcagcaccagagc
atggacatctctctgaccaagatggacaaccactgtgagctgctctcccggctcaagggg
aacttagaggaggagaatcatcacctgctgagccagatccagctgctgagtcagcagaac
cagatgctcctggaacagaacatggagagcaaggagcagtaccacgaggagcagaagcag
tacatagacaagttaaacgccttacggagacacaaggagaagctggaagaaaaaatcatg
gatcagtacaagttctatgaccctgctccaaagaagaagaaccactggattggagccaaa
gccctagtcaaacttatcaagccaaagaaagaaggttccagagaacggttaaaatccacc
acagatagccccccctggcagctggagccctcagaccctgcctcgccatctccctctcag
gctctcagatcgcagacggagaaccccgacaaccccccatcgggtccaaactgtgtggaa
gaacgagacacccacaacgggcctgtggggaaaggcccaggggatctaaaaccaaaacga
gggtccccgcgtggaggcagtgttgaccgcacagacacctccactgacccagctgtgaag
tcctggccctcggagcctggctcccggaccttttcaacctcagccaccacagcagccctt
tccagctccactcctatccccaagcacctaggccgcaccaaaggttgtaattcagatgac
aatctctgtgagccatcctcggagcccgacggcccctaccacaggcagcaggcatcgcgg
ccaaacagcttggagagcagtaggaacgcatccagcaacagctcgcctttgagcctaaag
ggctcctctgaccatctgcacagccggtgtgagagcttcagcagcgcagacctgatcccc
agcagggaccctgccacgctgtctcgggatggcaacacctcgggacgtggtcttctcggc
cgccatgagtaccctccaccccggaatgggcctgtctcccaggagactatccagaagaag
ggcgcagcttcaacccacacgggagtgcgaccccactcagcctctcccagcagtgagatg
gtcaccttggaggaatttttagaggagagtaaccgaggaggctctcctacccatgatact
cccagctgccgtgatgacctgcttagtgactacttccgaaaggcccatgatcccccagcc
ctgggaggccagccaggaccaccagctaggaaagatggagccaagatgcccaccagcttc
gtggctcccaccatcaagatgtcaatcaacacctctgaggggcagcagctgaagccaggg
cattatgtaaagcccaacctgagaccatctgaggccgaggccctggctgggatgccttca
agacaggtccagcctccccagagcctgtctctgggtagacccaggcaaaccacgatgacc
cagaattgtcacatgcctgtcagccgaagtgcgtctctgagcagagccttcagcctggct
tcagctgacctcctccgggccagtgggccagaagcctgtcggccagagtctcctcagaag
ccagggggtcatgaggctgcaggagccagagagacaagcacccacagcctgcaaggctcc
cacatcctagcccgggagagaacgccaatcgtaggaaaagctgacagtccctctccaggc
cagggtacccgaggccggccactggacacaagacgcttctctctggcccccccaaaggaa
gagaggctggcccccctacagcagtctgccacagccccagcccttgctactggatgtagc
agtggtagcaacccccagatccagcacttttctcctacagtggctcctgcagtcaggaca
aaatccaaagtgccacaacactcaggggaggtagccaccgtagctcctgtgcgtccaggg
ctcggcacctcagagggagatgggggcccagggcatggttacagcgaagggcttctgacc
aaaagccctggcaggtcttctgacttgcctccccatgtcaaaaggggccccgatgacttc
agtcaagggagcagttcaaagagcacaccggcgtccccagagccaggtggggacccgcag
acagtgtggtatgagtacggctgcgtgtga

DBGET integrated database retrieval system