KEGG   Mus musculus (mouse): 68349Help
Entry
68349             CDS       T01002                                 

Gene name
Ndufs3, 0610010M09Rik, CI-30kD
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S3
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
Module
mmu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    68349 (Ndufs3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    68349 (Ndufs3)
  09159 Environmental adaptation
   04714 Thermogenesis
    68349 (Ndufs3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    68349 (Ndufs3)
   05012 Parkinson disease
    68349 (Ndufs3)
   05016 Huntington disease
    68349 (Ndufs3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    68349 (Ndufs3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     68349 (Ndufs3)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     68349 (Ndufs3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 68349
NCBI-ProteinID: NP_080964
MGI: 1915599
Ensembl: ENSMUSG00000005510
Vega: OTTMUSG00000014317
UniProt: Q9DCT2
Structure
PDB: 

Position
2; 2 E1
AA seq 263 aa AA seqDB search
MAAAAARVWCRGLLGAASVGRGAGRPSVLWQHVRRESAAADKRPTVRPRSDVTHKQLSAF
GEYVAEILPKYVQQVQVSCLDELEICIHPDGVIPTLTFLRDHTNAQFKSLADLTAVDVPT
RQNRFEIVYNLLSLRFNSRIRVKTYADELTPIDSIVSVHIAANWYEREVWDMFGVFFFNH
PDLRRILTDYGFEGHPFRKDFPLTGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEA
FPAYRQPPESLKLEAGDKKPETK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgcagccagggtctggtgtcgtgggctcttgggggccgcttccgtaggc
aggggggctgggcgaccctccgtgctgtggcagcacgtaagaagggagagcgcggcggct
gacaagcgccccactgtcagaccccggagtgatgtgacccacaagcagctctcagcattt
ggagagtatgtggctgaaatcttacccaagtatgtccaacaagttcaggtgtcctgcctt
gatgagttagaaatctgtatccatcccgatggagtcatcccaacgctgacttttctcagg
gatcacaccaatgcacaattcaaatccttggctgacttgacggcagtggatgtcccaact
cggcagaaccgttttgagattgtctacaacctgctgtctctgcggttcaactctaggatt
cgtgtgaagacctatgcagatgagctgacacccattgactctatagtgtctgtgcacatc
gcggccaattggtatgagagggaggtctgggacatgtttggagttttcttttttaaccac
cctgatttaagaaggatcctgacagattatggcttcgagggacatcctttccggaaagac
tttcccctcactggctatgttgagcttcgttacgacgatgaggtaaagcgggtagtggct
gaaccagtggagctggcacaagaattccgcaagtttgacctgaacagcccctgggaggct
ttccctgcctatcgccagcctcctgagagtctcaagctcgaagctggagacaagaagcct
gaaaccaagtaa

DBGET integrated database retrieval system