KEGG   Mus musculus (mouse): 68352
Entry
68352             CDS       T01002                                 

Symbol
Aspdh, 0610012D14Rik
Name
(RefSeq) aspartate dehydrogenase domain containing
  KO
K06989  aspartate dehydrogenase [EC:1.4.1.21]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00760  Nicotinate and nicotinamide metabolism
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    68352 (Aspdh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.21  aspartate dehydrogenase
     68352 (Aspdh)
SSDB
Motif
Pfam: DUF108 NAD_binding_3 F420_oxidored 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 68352
NCBI-ProteinID: NP_080966
MGI: 1915602
Ensembl: ENSMUSG00000038704
Vega: OTTMUSG00000029000
UniProt: Q9DCQ2
Position
7; 7 B3
AA seq 287 aa
MATSTLPQVPYKVGVVGYGRLGQSLVSRLLAQGSELGLELVFVWNRDPGRMAGSVPPALQ
LQDLTALEERHPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALADQTTEQQLLEASKR
WGHTVFVARGALWGSEDISRLDAAGGLQSLRVTMATHPDGFRLEGPLAAAHSSGPRTVLY
EGPVRGLCPLAPRNSNTMAAAALAAPSLGFDRVIGVLVADLSLTDMHVVDVELLGPPGPS
GRSFAVHTHRENPAQPGAVTGSATVTAFWHSLLGCCQLTSRPGIHLC
NT seq 864 nt   +upstreamnt  +downstreamnt
atggccaccagtacgctccctcaagttccttacaaggtgggggtggtgggctatggccgc
ctgggacagtcccttgtgtcccgccttctggctcagggatcagaactgggcctagaactt
gtttttgtgtggaaccgtgaccctggacggatggcagggagtgtgccccctgccctgcag
ctccaagacctcactgcccttgaggaaaggcaccctgaccttgtggtagaagtggcccac
cccaaaataatccatgaatctggggcacaaatccttcgccatgcaaacctcctggtggga
tccccctcagctctggctgaccagaccacagagcagcagctcctggaggcttcaaagcgc
tggggccacactgtgtttgtggcccgaggggccctatggggcagtgaagacatcagcaga
ctggatgcagccggaggcctccagagccttcgagtcaccatggccacacatcctgatggc
ttccggctggagggacccctggctgcagcccacagtagtgggccccgcacagtgctctat
gagggccctgtgcgtgggctctgtcccttggccccccgaaactctaacaccatggcagct
gctgccctggctgcccccagtctaggcttcgaccgtgtcattggggtgcttgtggctgac
cttagcctcaccgacatgcacgtggtggatgtggagctgctaggacccccagggccttca
ggtcgcagctttgccgtgcacacccacagagagaacccagcccagcctggcgctgtcacc
ggctctgctactgttacagccttctggcacagcctactgggctgctgtcagctcacctcc
agacctgggatccacctctgctga

DBGET integrated database retrieval system