KEGG   Mus musculus (mouse): 68364
Entry
68364             CDS       T01002                                 

Symbol
0610030E20Rik, 1500031N04Rik, 2810411C16Rik, AI461894
Name
(RefSeq) RIKEN cDNA 0610030E20 gene
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: UPF0561
Other DBs
NCBI-GeneID: 68364
NCBI-ProteinID: NP_080972
MGI: 1915614
Ensembl: ENSMUSG00000058706
Vega: OTTMUSG00000057921
UniProt: Q149G0
Position
6 C1; 6
AA seq 166 aa
MEAAQDHGPGLCCKPGGRLDMSHGFVHHIRRNQLDRDDYDKKVKQAAKEKARRRHTPAPT
RPRKPDLQVYLPRHRDGSTHPVNPDCEEASESSSSGSSELEPPGRQLFCLDYEADSGEVT
SVIVYQDDDPGRVSEAVSAHTPLDPAMREALRSRIQEELAKRQSRH
NT seq 501 nt   +upstreamnt  +downstreamnt
atggaggcggcccaggatcacgggccggggttgtgctgcaagcccggcgggcgtctggac
atgagccacggcttcgtacaccacatccgtcggaaccagctcgatcgggacgactacgac
aagaaggtgaagcaggcggccaaggagaaggcgaggaggcgccacacgcccgcgcccacg
cggccccgcaagccagacctacaagtgtacctgccgcgccaccgagatggctccacccac
cccgtgaacccagactgtgaggaagccagtgaaagcagcagtagtggaagctccgagcta
gagcctcctggccgccagctcttctgtttagactatgaggcggacagtggcgaggtcact
tcagttattgtctatcaggacgatgatcctggaagggtgagtgaggcagtatcagcacac
acacctctggatccagccatgcgggaggccctcagatcgcgaatccaggaggaacttgca
aaacgccagagccggcactga

DBGET integrated database retrieval system