KEGG   Mus musculus (mouse): 68371
Entry
68371             CDS       T01002                                 

Gene name
Pbld1, 0610038K03Rik, Mawbp, Pb, Pbld
Definition
(RefSeq) phenazine biosynthesis-like protein domain containing 1
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: PhzC-PhzF
Other DBs
NCBI-GeneID: 68371
NCBI-ProteinID: NP_080977
MGI: 1915621
Ensembl: ENSMUSG00000112129
UniProt: Q9DCG6
Position
10; 10 B4
AA seq 288 aa
MKLPIFIADAFTATAFRGNPAAVCLLERTLEEDAHQQIAREMNLSETAFIRKLQPTDSFT
QSSRFGLRWFTPVSEVPLCGHATLASAAVLFHKIQNRNSTLTFVTMSGELKARRAEDGIV
LDFPVYPTFPQDFHEVEDLIKAAIGDTLVQDIRYSTDTRKLLVRLSDSYDRSFLESLKVN
TEPLPAIEKTGKVRGLILTVKGEPGGQTAPYDFYSRYFAPWVGIAEDPVTGSAHTVLSSY
WSQQLRKKEMRAFQCSRRGGELDISLRPDGRVDIKGGAVIVLEGTLTA
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaagctcccaatcttcatagcagatgcgttcactgcgacagctttccggggcaatcct
gccgcagtctgcctcctggagcgcacattggaggaagacgcccatcagcaaattgcgagg
gagatgaacctctcagaaacggctttcatcaggaaactgcagccgactgacagcttcaca
caaagctctcgctttggactgagatggtttacgccagtgagtgaagtccccttgtgcggc
cacgccacactggcctctgcggctgtgctgtttcacaaaatacagaacaggaacagcacc
ctgacctttgtcacaatgagcggggagctaaaggccagaagagcagaagatgggatagtc
ctggactttcctgtctacccaacctttccccaggacttccatgaagttgaagacttgata
aaggcagccataggtgacaccctggtccaggacatccggtactctacagataccagaaaa
ctcctggtccggctcagcgattcttatgacaggtcctttctagagagcctgaaggtgaac
acagagcctctgcctgcaattgagaagacagggaaggtgagaggcctcatcctcactgtc
aaaggagagcctggggggcagacggccccgtatgacttctactccagatacttcgcgccg
tgggttggtattgctgaagacccggtgacaggatctgcacacaccgttctcagcagttac
tggtcccagcagctcaggaagaaagagatgcgagcctttcagtgttcccgccgaggaggg
gagctggacatttccctgcgacctgatgggcgcgttgacataaagggcggagctgttatt
gtcttggagggcacgctgaccgcctag

DBGET integrated database retrieval system