KEGG   Mus musculus (mouse): 68396Help
Entry
68396             CDS       T01002                                 

Gene name
Nat8, 0610037O16Rik, ATase2, CCNAT, Cml4
Definition
(RefSeq) N-acetyltransferase 8 (GCN5-related)
  KO
K20838  N-acetyltransferase 8 [EC:2.3.1.80 2.3.1.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    68396 (Nat8)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.80  cysteine-S-conjugate N-acetyltransferase
     68396 (Nat8)
    2.3.1.-  
     68396 (Nat8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_9 Acetyltransf_4 Acetyltransf_CG FR47 DUF4131 Acetyltransf_3
Motif
Other DBs
NCBI-GeneID: 68396
NCBI-ProteinID: NP_075944
MGI: 1915646
Ensembl: ENSMUSG00000030004
Vega: OTTMUSG00000034547
UniProt: Q9JIY7
Position
6; 6 C3
AA seq 227 aa AA seqDB search
MASFRIRQFQERDYKQVVDVFSRGMEEHIPTAFRHLLTLPRTLLLLAVVPLAIVLVSGSW
FLAVVCIFFLFLFLWFLASKPWKNYVSKCLHTDMADITKSYLSVRGSGFWVAESGGQVVG
TVAARPVKDPPLGRKQLQLFRLSVSSQHRGQGIAKALTRTVLQFARDQGYSDVVLVTGLL
QQGAVTLYYSMGFQKTGESFVDILTWLVDVSLIHFIYPLPSAQKYEL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttttcgcatccgccagttccaggagagggactacaaacaggtcgtggatgtg
ttctccaggggcatggaggagcacatacccactgccttccgccacttgctgacactgccc
cgaaccctcctgctcttagctgtggtgccccttgccatagtcctggtgtctggctcctgg
ttcctggctgttgtatgcattttctttctgttcctattcttgtggttcctcgccagcaag
ccctggaagaattatgtgtccaaatgtttacacacagacatggctgacatcaccaagtcc
tacctgagtgtccgtggctcaggtttctgggtggctgagtctggggggcaggtggtgggt
acagtggctgctcggccagtcaaggatcctccgttagggaggaagcagctgcagctcttt
cgcctgtctgtgtcctcacagcatcgaggacaggggatagcgaaagcgctgaccagaact
gtcctccagtttgcaagggaccagggttacagtgatgttgtccttgtgactggccttttg
cagcaaggtgctgtgactctctactacagcatgggcttccagaagacaggtgaatccttc
gtggacatactcacatggcttgtggatgtttctctaattcatttcatatacccactccct
tctgctcaaaaatatgagttgtga

DBGET integrated database retrieval system