KEGG   Mus musculus (mouse): 68427
Entry
68427             CDS       T01002                                 

Symbol
Slc39a13, 1100001L14Rik, AA387663, ZIP-13, ZIP13
Name
(RefSeq) solute carrier family 39 (metal ion transporter), member 13
  KO
K14719  solute carrier family 39 (zinc transporter), member 13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    68427 (Slc39a13)
   05012 Parkinson disease
    68427 (Slc39a13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    68427 (Slc39a13)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   68427 (Slc39a13)
SSDB
Motif
Pfam: Zip
Other DBs
NCBI-GeneID: 68427
NCBI-ProteinID: NP_080997
MGI: 1915677
Ensembl: ENSMUSG00000002105
Vega: OTTMUSG00000014353
UniProt: Q8BZH0 B2RQ45
Position
2; 2 E1
AA seq 361 aa
MPGCPCPGCGMAGQRLLFLTVLALELLERAGGSQPALRSLGAAAACRLDNKESESWGALL
SGERLDTWICSLLGSLMVGLSGVFPLLVIPLEMGTLLQSEAGAWRLRQLLSFALGGLLGN
VFLHLLPEAWAYTCNITPGGEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNSKEDPSQAP
SKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLAVAASFLVS
KKIGLLTTMAILLHEIPHEVGDFAILLRAGFDRWTAAKLQFSTALGGLLGACFAICTQSP
KGVEETVVWILPFTSGGFLYIALVNVLPDLLEEDDPWHSLQQVLLLCSGVLVMVLLSLFV
E
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgcctggatgtccctgccctggctgtggtatggcaggccaaaggctcctcttcctcact
gtccttgccctggagctcctggaaagggctggaggttcccagccagccctccggagcctg
ggggctgcagctgcctgtcgcctggataataaagaaagcgagtcctggggggctttgctg
agtggggagcgactggacacctggatctgctccctcttgggctctctcatggttgggctc
agtggggttttccccttgctggtcattcccctggagatggggaccctgttacagtcagaa
gccggagcctggcgactgaggcagctgctcagctttgccttaggtggactcctgggcaac
gtgtttctgcacctgctgccggaggcgtgggcctacacctgtaacatcacccccggtggt
gaagggcagagtctgcagcgacagcaacaactggggctatgggtcatcgctggcttcctg
accttcctggcgttggagaagatgttcctcaacagcaaggaggaccccagccaggccccc
agcaaagaccccactgctgccgcgctcaatggaggccactgtctggcccagccggctgca
gagcccggcctgagagccgtggtccggaacctcaaagtcagtggctatctcaacctgctt
gccaacaccatagacaacttcactcatgggctggctgtggctgccagcttccttgtgagc
aaaaagatcgggcttctgaccaccatggccatcctcctgcatgagatcccccatgaggtg
ggtgactttgctatcctgctccgggctggctttgaccgatggacggcagctaagctacag
ttttctacagccctgggaggccttctgggggcctgctttgccatctgtacacagtccccc
aaaggagtagaggagacggtggtctggatcctgcccttcacctcgggaggctttctctat
atcgccctggtgaatgtgttacctgacctcttggaagaagacgacccgtggcactccctg
caacaggtgctgctgctctgctccggtgttctggtgatggtgctgctttcattgtttgtt
gaataa

DBGET integrated database retrieval system