KEGG   Mus musculus (house mouse): 68436
Entry
68436             CDS       T01002                                 
Symbol
Rpl34, 1100001I22Rik
Name
(RefSeq) ribosomal protein L34
  KO
K02915  large subunit ribosomal protein L34e
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03010  Ribosome
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    68436 (Rpl34)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    68436 (Rpl34)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    68436 (Rpl34)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    68436 (Rpl34)
  Archaea
    68436 (Rpl34)
SSDB
Motif
Pfam: Ribosomal_L34e Redoxin
Other DBs
NCBI-GeneID: 68436
NCBI-ProteinID: NP_001005859
MGI: 1915686
Ensembl: ENSMUSG00000062006
Vega: OTTMUSG00000023379
UniProt: Q9D1R9
Structure
Position
3:complement(130520476..130524047)
AA seq 117 aa
MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVR
PKVLMRLSKTQKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK
NT seq 354 nt   +upstreamnt  +downstreamnt
atggtccagcgtttgacataccgccgtaggctttcctacaacacagcctctaacaaaact
aggctgtctcgaacccctggcaacaggattgtttacctctacaccaagaaggttgggaaa
gcacctaaatctgcatgtggcgtgtgcccaggcagacttcgaggggttcgtgctgtgcgg
cccaaagtccttatgagactgtctaagacacagaagcacgtcagcagggcctatggcggc
tccatgtgtgccaagtgtgtccgtgacaggatcaagcgggctttccttattgaggagcag
aaaatcgttgtgaaagtcttgaaggcacaagcacagagtcagaaagcaaaatag

DBGET integrated database retrieval system