KEGG   Mus musculus (mouse): 68449
Entry
68449             CDS       T01002                                 

Gene name
Tbc1d10b, 1110003P22Rik, C87963
Definition
(RefSeq) TBC1 domain family, member 10b
  KO
K19944  TBC1 domain family member 10
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    68449 (Tbc1d10b)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    68449 (Tbc1d10b)
SSDB
Motif
Pfam: RabGAP-TBC DDHD
Other DBs
NCBI-GeneID: 68449
NCBI-ProteinID: NP_653105
MGI: 1915699
Ensembl: ENSMUSG00000042492
Vega: OTTMUSG00000029407
UniProt: Q8BHL3
Position
7; 7 F3
AA seq 798 aa
METGPAPLVAPPRRHGAPAAPSPPPRGSRAGSHLVVEPGPPVTTATSAPVELVAPGEARP
ACVPGSSQTSASTPTTATSSTVVMLTLEASPEAAKTQEFPAPAAETGAETSVALALGTDT
QKTEEVRASPVPGPGTPTRTPSRMAPGALTAKPPLAPKPGTTVASGVTARGGVGQVAGGH
EAATSASAGSVPEDPSGPVTGPPGTCEAPAPTPVAVVTVTPAPEPVENFQDLGSTSSLGP
GISGPRGQAPDTLSYLDSVSLMSGTLESLPDDVSSMGSDSEINGMALRKTDKYGFLGGSQ
YSGSLESSIPVDVARQRELKWLEMFSNWDKWLSRRFQKVKLRCRKGIPSSLRAKAWQYLS
NSKELLEQNPGKFEELERAAGDPKWLDVIEKDLHRQFPFHEMFAARGGHGQQDLYRILKA
YTIYRPDEGYCQAQAPVAAVLLMHMPAEQAFWCLVQICDKYLPGYYSAGLEAIQLDGEIF
FALLRRVSPLAHRHLRRQRIDPVLYMTEWFMCIFARTLPWASVLRVWDMFFCEGVKIIFR
VALVLLRHTLGSVEKLRSCQGMYETMEQLRNLPQQCMQEDFLVHEVTNLPVTEAWIEREN
AAQLKKWRETRGELQYRPSRRLHGSRAIHEERRRQQPPLGPSSSLLSLPSLKSRGSRAVG
GAPSPPPPVRRASAGPVPGAVVIAEGLHPSLPSPTGNSTPLGTSKEIRRQEKERQKQEKD
REKERQRQEKERERQEKERQKWEKEQEKEQQKQEKERQKLEKKGQGRKLSLRRRADGPPA
SHDGGDRSAAEARQDAYF
NT seq 2397 nt   +upstreamnt  +downstreamnt
atggagacgggtccggcgccccttgtggccccgccgcgccgccacggcgcccccgctgcc
ccttcgcccccgccccggggctcccgggccggatcgcacttagtggtggaaccgggaccg
ccagtgactacagccacttcggccccagtcgaattggtggcccccggggaggctcggccc
gcctgcgtcccaggatcatcacagacctcggcctctacacccacgacagctacgagcagc
acggtagtgatgctgaccctggaggcctcacccgaagccgcgaagacgcaagagttcccc
gcaccagcggcagaaacaggagccgagacgtcggtggctttggctttggggacagacact
caaaagacggaagaggttcgagcctctcctgtcccaggaccagggacccccactcggaca
ccttccagaatggcgcctggagccctgactgccaaacccccgcttgcccccaagccgggg
accacagtggcttcaggagtgactgcacggggtggagtaggacaggtggcaggtgggcat
gaagctgcgacctcagcatcagcagggtcggtgcctgaggacccctcagggcctgtcaca
ggccctcccgggacatgcgaggctccggctccgactccggtggctgtggtgacagtgacc
ccagctccggagcctgttgaaaactttcaagacctgggctccacgtccagtctaggacct
ggcatctcggggcctcggggtcaggccccagacaccctgagctacttggactccgtgagc
ctcatgtcagggaccttggagtccttgccggatgatgtgagctccatgggttcagactcg
gagataaatgggatggccctgcgcaagacggacaagtatggtttccttgggggcagccag
tactcaggcagcctagagagctctattccggtggatgtggctcgccagcgggagctcaag
tggctggagatgttcagtaactgggataagtggctgtcacggcgtttccagaaggtaaag
ctgcgctgccggaaaggaatcccctcctctctgagagccaaggcctggcagtacctgtct
aatagcaaggaactcctggagcagaaccctggcaagtttgaggagctggagcgggctgct
ggggaccccaagtggctcgatgtgattgagaaggacctgcatcgccagttccctttccat
gagatgtttgctgctcgaggagggcatgggcaacaggacctgtaccgaatcctgaaggcc
tataccatctacaggcctgacgagggctactgtcaggcccaggccccagtggctgcggtg
ttgctaatgcacatgcctgctgagcaagcgttttggtgcctggtacagatctgcgacaag
tacctcccaggttactacagtgcagggctggaagccattcagttggatggagaaatcttt
tttgcactcctgcgccgggtctctccgctggcacatcgtcaccttcggcggcagcgcatt
gaccctgtgctctacatgacagagtggttcatgtgcatctttgcccgcaccctcccctgg
gcttcagtgctgcgtgtctgggacatgtttttctgtgaaggcgttaagatcatcttccga
gtggctctggttttactgcggcacacactgggttctgtggaaaagctgcgctcatgtcaa
ggcatgtatgaaaccatggagcagcttcgaaacctaccacaacagtgtatgcaggaggac
ttcctggtgcatgaggtaaccaacctcccagtgacagaagcatggattgagcgggagaat
gcagcccaactgaagaagtggcgagaaactagaggagagctgcagtatcggccctcacgg
cgactacacggctcccgagccatccatgaggaacgcaggcggcagcagccacccctgggc
ccttcctctagcctcctcagcctccctagtctcaagagcagaggctcccgggcagttgga
ggggctccttccccaccacctcctgtccgcagggctagtgctgggcccgtccctggggct
gtcgtcattgctgagggactgcatccatcccttccttcacctactggtaacagcacccca
ctaggcaccagcaaggagatcaggcggcaggagaaagagcggcagaaacaggagaaagat
cgagagaaggagcggcagagacaagagaaggagcgggaaaggcaggagaaggagcggcag
aagtgggaaaaggagcaagagaaggaacagcagaagcaggagaaggagcggcagaagctg
gagaagaaaggccaaggccggaaactgtccttgcgtcgaagggcagatgggcccccggca
tcccatgatggtggggacaggtcagcagctgaggcccggcaggatgcttacttttga

DBGET integrated database retrieval system