KEGG   Mus musculus (mouse): 68465
Entry
68465             CDS       T01002                                 

Symbol
Adipor2, 1110001I14Rik, ADCR2, AI115388, AW554121, D6Ucla1e, Paqr2
Name
(RefSeq) adiponectin receptor 2
  KO
K07297  adiponectin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04920  Adipocytokine signaling pathway
mmu04932  Non-alcoholic fatty liver disease
mmu04936  Alcoholic liver disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    68465 (Adipor2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    68465 (Adipor2)
  09149 Aging
   04211 Longevity regulating pathway
    68465 (Adipor2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    68465 (Adipor2)
   04932 Non-alcoholic fatty liver disease
    68465 (Adipor2)
SSDB
Motif
Pfam: HlyIII
Other DBs
NCBI-GeneID: 68465
NCBI-ProteinID: NP_932102
MGI: 93830
Ensembl: ENSMUSG00000030168
Vega: OTTMUSG00000049368
UniProt: Q8BQS5 Q53YY3
Position
6:complement(119330111..119394489)
AA seq 386 aa
MNEPAKHRLGCTRTPEPDIRLRKGHQLDDTRGSNNDNYQGDLEPSLETPVCSSYYENSPE
EPECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWRVIPHDVLPDWLKDNDF
LLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQE
KVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFY
CNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFVGLGLSGIIPTLHYVISE
GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAF
VHFHGVSNLQEFRFMIGGGCTEEDAL
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgaacgagccagccaaacaccgattggggtgcaccaggactccagagccagatatacgg
ctcagaaaagggcaccaacttgatgatacaaggggaagtaataatgacaactaccaagga
gatttggagcccagcttagagacacctgtttgttcttcctattatgaaaatagcccggag
gagcccgagtgtcatgatgacaattcccaggaagatgaagggtttatgggcatgtccccg
ctcctacaggcccatcatgctatggaacgaatggaagagtttgtttgtaaggtgtgggaa
ggccgatggcgagtgatccctcacgatgtgctaccggattggcttaaggataatgacttc
cttctccatggacaccggcctcctatgccttcctttcgggcctgttttaagagcattttt
agaatacacacagagacgggcaacatttggacacatctcctaggttgtgtattcttcctg
tgcctggggatcttttatatgtttcgcccaaatatatcttttgtggcccctctgcaagag
aaagtggtctttggcttgttcttcttgggagccattctctgcctttccttttcatggctc
ttccacacggtgtactgccactcagaaggggtctcccgactcttctctaaattggattac
tctggtattgctcttctgatcatgggaagttttgttccttggctttattattctttctac
tgtaacccacaaccttgcttcatctacctgattgtcatctgtgtgctgggcattgcagcc
attatcgtctctcagtgggacatgtttgccacccctcagtatcggggggtcagagcagga
gtgttcgtgggcttaggcctgagtggaatcatccctaccttgcattatgtcatctcagaa
gggttcctgaaggctgccaccatagggcagataggctggctaatgcttatggctagcctc
tatatcaccggagctgccctctatgcggcccgtatccctgagcgcttctttcctggcaaa
tgtgacatctggtttcactctcatcagctcttccacatctttgtggttgctggtgccttt
gttcacttccacggagtctcaaacctgcaggaatttcgtttcatgattggcgggggctgc
actgaagaggatgcactgtga

DBGET integrated database retrieval system