KEGG   Mus musculus (mouse): 68480
Entry
68480             CDS       T01002                                 

Gene name
Card19, 1110007C09Rik, AI851695, Bincard
Definition
(RefSeq) caspase recruitment domain family, member 19
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: CARD
Other DBs
NCBI-GeneID: 68480
NCBI-ProteinID: NP_081014
MGI: 1915730
Ensembl: ENSMUSG00000037960
UniProt: Q9D1I2 B2RV71
Position
13; 13 A5
AA seq 183 aa
MTDQTYCDRLVQDTPFLTGQGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRV
RLCDLLSHLQQRGERHCQEFYRALYIHAQPLHSHLPSRYSPQNSDCRELDWGIESRELSD
RGPMSFLAGLGLAAGLALLLYCCPPDPKVLPGTRRVLAFSPVIIDRHVSRYLLAFLADDL
GGL
NT seq 552 nt   +upstreamnt  +downstreamnt
atgacagatcagacctactgtgaccggctggtacaggacactcctttcctgacgggacag
ggtcgcctgagcgagcaacaagtggacaggatcatcctccagctgaaccgttactaccca
cagatccttaccaacaaggaggctgaaaagttccggaaccccaaggcatccctgcgcgta
cggctctgtgacctcctgagccatctacagcagcgtggggaacggcactgtcaggaattt
taccgagctctgtacatccatgcccagcccctgcacagccacctgcccagccgctactct
cctcaaaactcagattgcagagagctggactggggcatcgagagccgtgagctgagtgac
aggggacccatgagcttcctggcaggcctgggcctggcagcgggcctggccctcctcctc
tactgctgccctccagaccccaaagtgctgcccggaacccggcgcgtccttgccttctca
cctgtcatcattgaccggcatgtcagccgctacctgctggctttcctggcagatgacctc
ggaggactctga

DBGET integrated database retrieval system