KEGG   Mus musculus (house mouse): 68497
Entry
68497             CDS       T01002                                 
Symbol
Arel1, 1110018G07Rik, AI649076, AW610792
Name
(RefSeq) apoptosis resistant E3 ubiquitin protein ligase 1
  KO
K22370  apoptosis-resistant E3 ubiquitin protein ligase 1 [EC:2.3.2.26]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    68497 (Arel1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     68497 (Arel1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   68497 (Arel1)
SSDB
Motif
Pfam: HECT Filamin GAP1-M
Other DBs
NCBI-GeneID: 68497
NCBI-ProteinID: NP_835166
MGI: 1915747
Ensembl: ENSMUSG00000042350
UniProt: Q8CHG5
Position
12:complement(84964914..85017674)
AA seq 823 aa
MFYVIGGIIVSVVAFFFTIKFLFELAARVVSFLQNEDRERRGDRTIYDYVRGNYLDPRSC
KVSWDWKDPYEVGHSMAFRVHLFYKNGQPFPAHRPVGLRVHISHVELAVDIPVTQEVLQE
PNSNVVKVAFTVRKAGRYEITVKLGGLNVAYSPYYKIFQPGMVVPSKTKIVCHFSTLVLT
CGQPHTLQIVPRDEYDNPTNNSMSLRDEHSYSLAIHELGPQEEENNEVSFEKSVTSNRQT
CQVFLRLTLHSRGCFHACISYQNQPINNGEFDIIVLSENEKNIVERNVSTSGVSIYFEAY
LYNANNCTSTPWHLPPMHMSSSQRRPSTAIEEDDEDSPSECHTPEKVKKPKKVYCYVSPK
QFSVKEFYLKIIPWRLYTFRVCPGTKFSYLGPDPVHKLLTLVVDDGIQPPVELSCKERNI
LAATFIRSLHKNIGGSETFQDKVNFFQRELRQVHMKRPHSKVTLKVSRHALLESSLKATR
NFSISDWSKNFEVVFQDEEALDWGGPRREWFELICKALFDTTSQLFARFTDSNQALVHPN
PNRPAHLRLKMYEFAGRLVGKCLYESSLGGAYKQLVRARFTRSFLAQIIGLRMHYKYFET
DDPEFYKSKVCFILNNDMSEMELVFAEEKYNKSGQLDKIVELMTGGAQTPVTNANKIFYL
NLLAQYRLASQVKEEVEHFLKGLNELVPENLLAIFDENELELLMCGTGDINVSDFKAHAV
VVGGSWHFREKVMRWFWAVVSSLTQEELARLLQFTTGSSQLPPGGFAALCPSFQIIAAPT
HSTLPTAHTCFNQLCLPTYDSYEEVHRMLQLAISEGCEGFGML
NT seq 2472 nt   +upstreamnt  +downstreamnt
atgttttacgttattggtggaatcatagtgtctgtggttgcattcttcttcacaattaag
ttcctctttgagcttgccgcacgtgtagtcagctttcttcagaatgaagaccgtgagcgc
cgaggggaccggactatttatgactacgtgcggggaaattacctggatccccggtcctgc
aaagtgtcctgggattggaaggacccctatgaggtgggccacagcatggccttccgagtg
catttgttctataagaatggacagcctttccctgcacatcggcccgtgggactgcgggtt
cacatctctcacgttgaactagcagtggacattccagtgacccaggaagtcctccaggag
ccgaattctaacgtggtgaaggtggccttcactgtgcgcaaggctgggcgctatgagatc
actgtgaagttgggtggcttaaatgtggcctatagtccctactacaaaatttttcagcct
ggaatggtggttccttccaaaacaaaaattgtgtgccatttttctactctggtgttgacg
tgtgggcagccacacactctgcagatagtgccccgagatgagtatgacaacccaaccaac
aattccatgtccctgagagatgagcacagctacagcttagccattcacgagcttggtcct
caagaagaagagaataatgaagtctcatttgagaagtcagtgacgtccaacaggcagact
tgccaggtgttcttgcggctcaccctgcattcccgaggttgcttccatgcctgcatttca
tatcagaaccaacccatcaataatggcgaatttgacattattgtccttagtgagaatgag
aagaatattgttgaacgaaatgtgtccacctcaggagtgagcatttactttgaggcttac
ctttacaatgctaacaactgtaccagcacaccatggcatcttcctcccatgcacatgagc
tcttctcaacgccggccctccactgctattgaggaggacgatgaagactcaccctcagag
tgtcacacccctgagaaggtgaagaaaccgaagaaggtgtactgctatgtgtcaccaaag
caattctctgtgaaggaattctacctgaaaatcatcccctggcgcctctacaccttccga
gtgtgcccaggaacaaagttttcataccttggccctgaccctgttcacaagctcctcacg
ctggtggtggatgacggcattcagcctccagtggagctcagctgtaaagaaaggaatatc
ctagcagccactttcatccgttccttgcacaagaacattggaggctctgagacctttcaa
gacaaggtgaactttttccagagagagcttcggcaggtacatatgaagagacctcattcc
aaagtcactctgaaggtcagcagacacgccttgttggagtcgtctttgaaggccactcgg
aacttttccatctcagactggagcaagaactttgaagtagttttccaggatgaggaagct
ttggattggggagggcctcgccgggaatggtttgagctaatctgcaaagcactgtttgac
accaccagtcagctcttcgcccggttcactgacagcaaccaagcactagtgcatcctaac
cctaaccgcccggctcacctgcgcttgaagatgtatgagtttgcagggcggctggtgggc
aagtgtttgtatgaatcctctctagggggagcctacaagcagttggtccgtgcccggttc
actcggtctttcctggcccaaatcataggactccgtatgcattacaagtactttgaaacg
gatgacccagaattctataagtccaaggtgtgctttatcctcaacaatgacatgagtgag
atggagctggtctttgcagaagagaaatacaacaaatcaggtcaactggataagattgta
gaactcatgacaggcggagctcaaaccccagtcaccaatgcaaataaaatcttctattta
aacctgctggctcagtatcggctggccagtcaagtgaaagaggaggtggagcatttcctg
aaaggcttgaatgagctggttcctgagaacctcctggctatttttgatgagaatgagctt
gagctgctgatgtgtgggactggagacatcaatgtatctgacttcaaagcccatgctgta
gtggttggtggatcctggcatttcagagaaaaggtcatgaggtggttttgggctgtggtt
tccagtctgacccaggaggaactggctaggctgcttcagtttacaacaggctcttctcag
ctcccacctggaggatttgctgccctctgtccctcatttcagattattgctgctccaacc
catagcacgcttcctactgcacacacatgttttaaccaactgtgcctccctacatatgac
tcatatgaagaggtgcacaggatgctacagctggccatcagtgagggttgcgagggcttt
ggcatgctctga

DBGET integrated database retrieval system