KEGG   Mus musculus (house mouse): 68512
Entry
68512             CDS       T01002                                 
Symbol
Tomm5, 1110019J04Rik, Tom5
Name
(RefSeq) translocase of outer mitochondrial membrane 5
  KO
K17773  mitochondrial import receptor subunit TOM5
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    68512 (Tomm5)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    68512 (Tomm5)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    68512 (Tomm5)
Transporters [BR:mmu02000]
 Other transporters
  Primary active transporters [TC:3]
   68512 (Tomm5)
SSDB
Motif
Pfam: Tom5
Other DBs
NCBI-GeneID: 68512
NCBI-ProteinID: NP_001093145
MGI: 1915762
Ensembl: ENSMUSG00000078713
UniProt: B1AXP6
Position
4:complement(45105209..45108113)
AA seq 51 aa
MFRIEGLAPKLDPEEMKRKMREDVVSSIRNFLIYVALLRVTPYILKKLDSI
NT seq 156 nt   +upstreamnt  +downstreamnt
atgttccggatcgagggtctcgcgcccaagttggacccggaggagatgaagcggaagatg
cgtgaggatgtggtctcctccattcggaacttcctcatctacgtggccctgctgcgagtc
actccatatatcttaaagaagctggatagcatctga

DBGET integrated database retrieval system