KEGG   Mus musculus (house mouse): 68514
Entry
68514             CDS       T01002                                 
Symbol
Micu2, 1110008L20Rik, 4833427E09Rik, Efha1, Smhs2
Name
(RefSeq) mitochondrial calcium uptake 2
  KO
K22828  calcium uptake protein 2, mitochondrial
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    68514 (Micu2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    68514 (Micu2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Mitochondrial calcium uniporter complex
    68514 (Micu2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  Calcium binding proteins
   68514 (Micu2)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 23S_rRNA_IVP
Other DBs
NCBI-GeneID: 68514
NCBI-ProteinID: NP_082919
MGI: 1915764
Ensembl: ENSMUSG00000021973
UniProt: Q8CD10
Structure
Position
14:complement(58153718..58236753)
AA seq 432 aa
MAAAAGRSAWLAAWGGRLRRGLAAGRRAVPTRGPLAAAVAGVALAGAGAAWHHGRVKAAA
REGSRTVSAQKNYLGPIEKLSLRKQRFMQFSSLEHDGEYYMTPRDFLFSVMFEQVERKTL
VKKLAKKDIEDVLSGIQTARCGSTFFRDLGDKGVISYTEYLFLLTILTKPHSGFHVAFKM
LDVDGNEMIERKEFVKLQKIISKQDGFKTVKTNETEYQDPTVKEPGVNTTLQVRFFGKRG
EKKLHYKEFRRFMENLQTEVQEMEFLQFSKGLNFMRKEDFAEWLLFFTNTENKDIYWRNV
REKLSVGESISLDEFKSFCHFTTHLEDFAIAMQMFSLAHRPVRLAEFKRAVKVATGQELS
DNLLDTVFKIFDLDGDECLSHGEFLGVLKNRMHRGLWVSQQQSVQEYWKCVKKESIKGVK
EAWRQQAGKGPF
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggcggcggctgcgggaagaagcgcttggctggcggcctggggcggaaggctgcggcgc
gggctcgcggccggccgacgagctgtgccgactcgcggccctctcgcagcggctgtggcc
ggggtagccctggcaggcgcaggagcggcatggcatcacggccgcgtgaaagcagccgcg
cgcgagggctcccgaacggtgtcggcgcagaaaaattatttgggaccaatagagaaactt
tctctccgcaaacagcggttcatgcagttttcatccctggagcacgacggagagtattac
atgacaccccgagacttcctcttctcagtcatgtttgagcaagtggagcgtaaaacactg
gtcaagaagctggcaaaaaaggatatcgaggatgtactgtcaggaatccaaacagcacgc
tgtggatcaacattttttagagacctgggtgataaaggggtaatttcatataccgagtat
cttttcttgcttacaatcctcacaaaacctcactctgggttccatgttgcttttaaaatg
ctggatgtggatgggaatgagatgatcgagaggaaggagtttgttaagctgcagaagatc
ataagtaaacaagatggcttcaagacagtgaagactaatgagacagaataccaggaccca
acagtgaaagagcctggcgttaacacaacccttcaagtgcgtttctttgggaaaagagga
gaaaaaaaactccattataaagaatttcgaagatttatggaaaatttacaaacagaagtt
caagaaatggaattccttcagttctctaaaggcctgaatttcatgagaaaagaagacttt
gcagaatggctacttttcttcactaacactgaaaataaagatatttactggagaaacgtg
agagaaaagttgtcagtaggagagagcattagtttggatgagttcaagtccttttgccat
tttacaacgcatttggaagactttgctatcgccatgcaaatgtttagtttagctcatcgc
cctgtgcggctggcagagttcaagagagctgtgaaggtagcgactggacaggagctctcg
gacaatcttctggacaccgtcttcaagatctttgacctggacggggacgagtgcctcagc
cacggcgagttccttggggtactgaaaaacaggatgcaccgaggcttatgggtgtcacag
cagcagagtgtgcaagaatactggaagtgtgtgaagaaggaaagcatcaagggagtaaag
gaagcctggagacaacaagccggcaagggccccttctaa

DBGET integrated database retrieval system