KEGG   Mus musculus (mouse): 68515
Entry
68515             CDS       T01002                                 

Symbol
Myadml2, 1110012N22Rik
Name
(RefSeq) myeloid-associated differentiation marker-like 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: MARVEL Otopetrin
Other DBs
NCBI-GeneID: 68515
NCBI-ProteinID: NP_081027
MGI: 1915765
Ensembl: ENSMUSG00000025141
Vega: OTTMUSG00000004089
UniProt: Q08AU7
Position
11; 11 E2
AA seq 307 aa
MGSTMEPPGGAYLHLGAVTSPVGTARMLQLAFGCTTFSLVAHRGGFGGVQGTFCMAAWGF
CFAFSVLVVACEFTKLHSCLRLSWGNFTAAFAMLATLLCATAAVIYPLYFTRLECPPEPA
GCMVRNFRLAASVFAGLLFLAYAAEVALTRARPGQVASYMATVSGLLKIVQAFVACIIFG
ALVHESRYGRYVATQWCVAVYSLCFMATVAVVVLSVMGHTAGLGCPFDRLVIVYTFLAVL
LYLSAAVIWPVFCFDPKYGEPGRPADCLRGSCPWDSQLVVAIFTYVNLLLYIVDLAYSQR
IRFVPTL
NT seq 924 nt   +upstreamnt  +downstreamnt
atgggcagcaccatggagcccccagggggtgcatacctgcacttaggcgctgtgacctcg
ccggtgggtacagcccgaatgctgcagctggcctttggctgtaccactttcagtttggtt
gctcaccgaggtggttttgggggtgtccagggcactttctgcatggctgcttggggcttc
tgttttgccttctcagtcttggtggtagcctgtgagttcacaaagcttcacagctgcctg
cgcctttcctggggcaacttcacagcagccttcgccatgttggcgaccctgctgtgtgcc
acggccgctgtcatctaccctctgtacttcacccgactggagtgcccacctgagcctgcc
ggatgcatggtacgaaacttccgcctggcagccagcgtcttcgcaggactcctcttcctg
gcctatgcggctgaagtggccctgactcgggctcggccaggtcaggtagccagctatatg
gctacagtgtctgggctccttaagatcgtccaggcctttgtggcctgcatcatctttgga
gcacttgtccacgagagtcgctacgggcgctacgtggccacacagtggtgtgtggctgtc
tacagcctgtgcttcatggccacagtggctgtggtggtcctaagcgtgatgggacacacg
gcaggcctggggtgcccgtttgaccgcctagtgatagtgtatacgttcctggctgtgctc
ctatacctcagcgctgcagtcatctggccagtcttctgttttgaccccaagtacggggag
ccagggcggcccgcggactgcctgcgaggcagctgcccctgggacagccaattggtggta
gctattttcacctacgtcaacctgctcctttacattgttgacctcgcttattcccagagg
atccgcttcgtgcccaccctgtag

DBGET integrated database retrieval system