KEGG   Mus musculus (mouse): 68539Help
Entry
68539             CDS       T01002                                 

Gene name
Tmem109, 1110006I15Rik, AA958958, C77652
Definition
(RefSeq) transmembrane protein 109
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: BRI3BP PEP-CTERM Clp_N
Motif
Other DBs
NCBI-GeneID: 68539
NCBI-ProteinID: NP_598903
MGI: 1915789
Ensembl: ENSMUSG00000034659
Vega: OTTMUSG00000033009
UniProt: Q3UBX0
Position
19; 19 A
AA seq 243 aa AA seqDB search
MAGAHSTPLWSRHLLKAVLMVLVALFLVHSASAQSHREFASPGQQKKETSADILTQIGRS
LKEMLDTWLGPETMHVISETLLQVMWAISSAISVACFALSGIAAQLLSALGLDGEQLTQG
LKLSPSQVQTLLLWGAAALVIYWLLSLLLGLVLALLGRILGGLKLVLFVAGFVALVRSVP
DPSTRALMLLALLTLFALLSRLTGSRSSGSHLEAKVRGLERQIEELRGRQRRAAKMPRSM
EEE
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgcacacagcactccgttatggagcagacatctgctcaaagctgtcctgatg
gtcctcgtggcccttttcctcgtccactccgcatcagcccagtctcatcgagagtttgcc
tcacctggtcaacagaagaaggagacctcagctgatattttgacccagattggccgatct
ctgaaggagatgttggatacctggctagggccagagaccatgcatgtgatttcagagacc
ctgttgcaggtgatgtgggccatctcatcagccatctctgtggcctgctttgccctgtct
gggattgctgcccagttgctgagtgccctggggctggatggtgaacaactcacccagggc
ttgaagctcagccctagccaagtccagacccttctactgtggggagcagcagcactggtc
atctactggttgctgtccctgctcctaggcttggtcttggccttgctagggaggatcctg
gggggtctgaaacttgttctttttgtcgctggctttgtggccctggtgaggtctgtgccc
gacccatctacccgggccttgatgctcttggccttgttaactctctttgccttgctgagc
cggctcactggctccaggagctcagggagccacctggaagccaaggtgagagggctggag
cgccagatagaagagcttagagggaggcagaggcgagcagccaagatgcccaggagcatg
gaagaagagtga

DBGET integrated database retrieval system