KEGG   Mus musculus (house mouse): 68550
Entry
68550             CDS       T01002                                 
Symbol
Tefm, 1110002N22Rik
Name
(RefSeq) transcription elongation factor, mitochondrial
  KO
K17658  transcription elongation factor, mitochondrial
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    68550 (Tefm)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    68550 (Tefm)
SSDB
Motif
Pfam: HHH_3
Other DBs
NCBI-GeneID: 68550
NCBI-ProteinID: NP_899098
MGI: 1915800
Ensembl: ENSMUSG00000046909
UniProt: Q5SSK3
Position
11:complement(80027500..80033697)
AA seq 364 aa
MAWRTNLACLIKAGGRRWFPVPEYSSLPPVLNNTCSVRKSTAPEKRVASVAACDTDGKEP
GNPLDRLFSLEQQASILQVLNTASDKELEAFRLLRGRKSVNIVEHRKKFGPFQRLENLID
VPLIQYKTAVEVCNSILCPENRRRKKSQEKWLLRKFIKPGVEQERLKAVKSIVSIVFGTR
RIAWAHLDRRPTVLDWQQTECWKLTNKTYPTSFYLEEISSVISKIPKADLYILEKSGLSI
QNTSLLPILLHFLITEAMLYALLNKTFAEDGQHRVLSINRNAVGKHFDLMIGDTRTSGRE
LVKQFLSESVLKERPRVFFPQDLLVQYRQKVVKSSYRIEELYDSLLQAVAFYELVFGKDS
ELKC
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcttggaggacaaaccttgcttgcctcatcaaggccggagggaggagatggtttcca
gtcccagagtactcatccctgcctccagtcctaaataacacctgctctgtgaggaaatcc
actgcacctgagaaacgtgttgccagtgttgctgcttgtgatacagatggaaaggagccc
gggaatccattggacaggctcttctccctggagcagcaggcttctatcttacaagtgctg
aatacagcttctgataaagaactggaagctttcaggttgcttcgaggaaggaagtccgtc
aatattgtagaacacagaaagaagtttgggccgtttcagaggttggagaatttgatagac
gtgcccttgatccaatataaaactgctgttgaagtttgtaactccattctctgtccggag
aacagacggaggaaaaagtcacaggagaagtggctgctgagaaagttcatcaagccaggt
gtagagcaagagagacttaaggcagttaagagtatcgtatctattgtttttggtactcga
agaattgcatgggctcaccttgaccggagaccgactgtgctggactggcagcagactgag
tgctggaaattaactaacaaaacatacccaacgtccttttatctggaagagatttcttca
gtcatttcaaagatacctaaagcagatctctacattttggaaaaatcaggactttccatt
cagaacacatctctgcttcctatactgttacactttcttatcacggaagccatgctgtat
gccttactcaacaaaacttttgccgaggatggccagcaccgcgtgctgagcataaatcga
aatgcggtgggcaagcactttgacctgatgatcggcgacacgaggacgagtgggagggag
ctagtgaagcagttcctctctgagtctgtgctgaaggagcggcctcgggtgttcttccca
caggacctcttagtgcagtacagacagaaggttgtcaagagctcataccggattgaagag
ttgtatgactcattattacaagctgttgctttttatgagttagtttttggcaaagactca
gagctcaaatgttaa

DBGET integrated database retrieval system