KEGG   Mus musculus (house mouse): 68552
Entry
68552             CDS       T01002                                 
Symbol
Smim14, 1110003E01Rik, 1700127H04Rik, 5430439C17Rik, MAd4
Name
(RefSeq) small integral membrane protein 14
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DUF2615 RACo_linker
Other DBs
NCBI-GeneID: 68552
NCBI-ProteinID: NP_598458
MGI: 1915802
Ensembl: ENSMUSG00000037822
UniProt: Q91VT8
Position
5:complement(65604187..65694492)
AA seq 99 aa
MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLRELPGPSSDSGISITVILMAW
MVIAMLLFLLRPPNLRGSSLPGKPSSPHSGQDPPAPPVD
NT seq 300 nt   +upstreamnt  +downstreamnt
atggctgaaggaggatttgacccctgtgaatgtgtctgctctcacgaacatgctatgagg
aggctcatcaatctgctccggcagtcccagtcctactgcaccgacacagagtgccttcgg
gagttgccaggaccctccagtgacagtggcatcagcatcactgtgatcctgatggcctgg
atggtgatcgccatgctcctcttccttctgaggcctcctaacctgagaggctccagcctc
cctggaaagccctccagtcctcacagtggacaggacccgccagcccctcccgtggactaa

DBGET integrated database retrieval system