KEGG   Mus musculus (mouse): 68556
Entry
68556             CDS       T01002                                 

Symbol
Uckl1, 1110007H10Rik, Urk, Urkl1
Name
(RefSeq) uridine-cytidine kinase 1-like 1
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00240  Pyrimidine metabolism
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    68556 (Uckl1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    68556 (Uckl1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine/cytidine kinase
     68556 (Uckl1)
SSDB
Motif
Pfam: UPRTase PRK CPT AAA_18 Cytidylate_kin AAA_33 Zeta_toxin CoaE
Other DBs
NCBI-GeneID: 68556
NCBI-ProteinID: NP_081041
MGI: 1915806
Ensembl: ENSMUSG00000089917
Vega: OTTMUSG00000016737
UniProt: Q91YL3
Position
2; 2 H4
AA seq 548 aa
MAAPPASMSAAPSPLQSAVAPDVPGRQAEQNETACEDRSNAGTLDRLLPPVGTGRSPRKR
TTSQCKSEPPLLRTSKRTIYTAGRPPWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIE
ALDVPWVVLLSMDSFYKVLTQQQQEQAACNNFNFDHPDAFDFDLIISTLKKLKQGRSVQV
PIYDFTTHSRKKDWKTLYGANVIIFEGIMAFADKTLLELLDMKIFVDTDSDIRLVRRLRR
DISERGRDIEGVIKQYNKFVKPAFDQYIQPTMRLADIVVPRGSGNTVAIDLIVQHVHSQL
EERELSVRAALASAHQCHPLPQTLSVLKSTPQVRGMHTIIRDKETSRDEFIFYSKRLMRL
LIEHALSFLPFQDCTVQTPQGQDYVGKCYAGKQITGVSILRAGETMEPALRAVCKDVRIG
TILIQTNQLTGEPELHYLRLPKDISDDHVILMDCTVSTGAAAMMAVRVLLDHDVPEDKIF
LLSLLMAEMGVHSVAYAFPRVRIITTAVDKRVNDLFRIIPGIGNFGDRYFGTDAVPDGSD
DDEAATVG
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggctgcgccgccggcctcaatgagcgccgccccttcgcccctgcagtctgctgtggcc
ccagacgtgcctggccgccaggccgagcagaatgaaacggcgtgcgaggaccgcagcaat
gcagggaccttggacagacttctcccaccagtgggtactgggcgctcaccccggaagcgc
accaccagccagtgcaagtcagaaccacccctgcttcgcacaagcaaacgtaccatctac
acagctgggcggccaccatggtacaatgaacatggtacacagtccaaggaggcctttgct
attggcttaggaggtggcagtgcatctgggaagaccactgtggccagaatgatcattgag
gcactagatgtgccctgggtggtcctgttgtccatggactccttctataaggttctgacg
cagcagcagcaggaacaggctgcctgtaacaatttcaactttgaccaccctgatgccttt
gacttcgatctcatcatttccacccttaagaagctaaaacagggcaggagtgtccaagtg
cccatctatgatttcactacccatagccggaaaaaggactggaaaaccctgtatggtgcg
aatgtcatcatctttgagggtatcatggcctttgctgataagacactgctggagctcctg
gacatgaagatctttgtggacacggactctgatatccgactggttcggcgtctgcgcagg
gacatcagcgaacgaggccgggacattgagggtgtcattaagcagtacaacaagtttgtc
aaacctgcatttgatcagtatatccagcctaccatgcggctggcagatattgtggtgccc
agagggagcgggaacacagtagccattgacctgattgtgcagcatgttcacagccagctg
gaagagcgcgaactcagcgtcagggccgcgttggcctccgctcaccagtgccatcccctc
ccccagacactgagtgtcctcaagagtacaccgcaggtccgaggcatgcacaccatcatc
agggacaaggagactagccgggatgaattcatcttctactccaaaagactgatgcggctg
cttattgaacatgcactgtccttcctaccctttcaggactgcactgtacagactccacag
gggcaggactacgtgggaaagtgctacgctggaaaacagatcaccggcgtgtcaattctg
cgtgcaggagaaaccatggagcctgcactgcgtgccgtgtgcaaggatgtgcgcatcggc
actatcctcatccagaccaaccagctcacaggggagcctgagctccattacctgaggctt
cccaaggatatcagtgatgaccatgtgatcctgatggactgcacagtatccacaggtgct
gcggccatgatggctgtacgtgtactcctggaccatgatgtgcctgaggacaagatcttt
ttgctgtccctgctcatggcagagatgggtgtgcattctgtggcctacgctttcccacgc
gtgagaatcatcaccacagctgtggacaagcgtgtcaatgaccttttccgtatcatccca
ggcattgggaactttggtgatcgctactttgggacagatgcagtccctgatggcagtgat
gatgatgaggcagccactgtgggttag

DBGET integrated database retrieval system