KEGG   Mus musculus (mouse): 68572
Entry
68572             CDS       T01002                                 

Symbol
Mrpl58, 1110001A02Rik, 1110002E03Rik, Ict, Ict1, MRP-L58
Name
(RefSeq) mitochondrial ribosomal protein L58
  KO
K15033  peptidyl-tRNA hydrolase ICT1 [EC:3.1.1.29]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    68572 (Mrpl58)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.29  aminoacyl-tRNA hydrolase
     68572 (Mrpl58)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Release factors
   68572 (Mrpl58)
SSDB
Motif
Pfam: RF-1 NOG1_N pEK499_p136
Other DBs
NCBI-GeneID: 68572
NCBI-ProteinID: NP_001334574
MGI: 1915822
Ensembl: ENSMUSG00000018858
Vega: OTTMUSG00000003439
UniProt: Q8R035
Structure
PDB: 
1J26

Position
11; 11 E2
AA seq 206 aa
MATAWGLRWGLSRTGTLLLAPPARCARRALHRQVDGTTFQSIYSLDKLYPESKGADTAWK
VPEHAKQASSYIPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIEEPVRQKIA
LTHKNKINKAGELVLTSESSRYQFRNLAECLQKIRDMIAEASQVPKEPSKEDARLQRLRI
EKMNRERLRQKRLNSALKTSRRMTMD
NT seq 621 nt   +upstreamnt  +downstreamnt
atggcgaccgcctggggcctacgctggggcctgagccgaactggaacgttgttgctcgcg
ccgcccgcgcgctgtgctcgccgggctctgcacagacaggtagacggcaccacgttccag
agcatctacagcctggacaagctgtaccccgagtccaagggcgcggataccgcctggaag
gtcccggagcatgcaaaacaagccagcagttacatccctctggatcggttaagcatatct
tactgtcggagcagcggtcctggtgggcagaatgtgaacaaagtgaattccaaggctgaa
gtaaggtttcacttggccagtgcagactggattgaggagcccgtgcgccagaagattgcc
ctcacgcataaaaataagatcaacaaggcaggagagctggtacttacctctgagagcagc
cggtatcagttccgcaatctggcagaatgcctacagaaaattcgagacatgattgccgag
gccagccaggtacccaaagagccatccaaggaagatgctcggcttcagagactcaggatt
gaaaagatgaatcgggaaaggctacgacagaaaagactaaactctgccctaaagaccagc
aggaggatgactatggactga

DBGET integrated database retrieval system