KEGG   Mus musculus (mouse): 68597Help
Entry
68597             CDS       T01002                                 

Gene name
Ccdc167, 1110021J02Rik
Definition
(RefSeq) coiled-coil domain containing 167
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: CCDC-167 DUF3375 CENP-F_leu_zip ACCA Spc24 DUF4337
Motif
Other DBs
NCBI-GeneID: 68597
NCBI-ProteinID: NP_081058
MGI: 1915847
Ensembl: ENSMUSG00000024018
Vega: OTTMUSG00000033064
UniProt: Q9D162
Position
17 A3.3; 17
AA seq 97 aa AA seqDB search
MTKKKRENLGVAQEIDGLEEKLSRCRKDLEAVTSQLYRAELSPEDRRSLEKEKHTLMNKA
SKYEKELKLLRHENRKNTLLSVAIFTVFALLYAYWTM
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaagaagcgggagaatcttggtgtcgctcaggagattgacgggctagaggaa
aagctgtcccggtgtcggaaggacctggaggccgtgacctcccagctttacagggcagag
ctcagtcctgaggacaggaggtctctggagaaggagaaacacaccctcatgaacaaagcc
tccaagtatgagaaagagctaaagctgcttcgacatgagaaccggaagaacacgctcctc
tcggtggccatcttcactgtcttcgccctgctctatgcttactggactatgtga

DBGET integrated database retrieval system