KEGG   Mus musculus (mouse): 68614
Entry
68614             CDS       T01002                                 

Gene name
Letmd1, 1110019O13Rik, AI593524, BB130465, BB235638, HCCR, HCCR-, HCCR-2, HCCR1, MCC-32, Mccr
Definition
(RefSeq) LETM1 domain containing 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: LETM1
Other DBs
NCBI-GeneID: 68614
NCBI-ProteinID: NP_598854
MGI: 1915864
Ensembl: ENSMUSG00000037353
UniProt: Q924L1
Position
15; 15 F1
AA seq 360 aa
MALSRVCWARAALWGSTVAPGPFVTRRLQLGRSGPAWRAPRSSKLHLSPKADVKNLISYV
VTKTRAINGSYHRFLGRHFPRFYALYTTFMKGIQMLWADGKKARRIKADMWKQNLKFHQL
SYREMEHLRQFRRDITKCLFVGLISIPPFANYLVFLLMYLFPRQLLVKHFWTPKQQIDFL
DVYHGLRRRSHSEVITHLRRASTFVSHEKLRRQLTDLCTKVQSGTHPAAQDVLALRDCFS
TYPLGFSQLQASQMRALSQAMLLTPYLPPPLLRQRLKSHTTVIHQLDRALAKLGIGQLTA
QEVKSACYLRGLNSTHIADDRCRAWLGEWLHISCSLKEPELSLLLHNVVLLSTNYLETRR
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcgctgtccagggtgtgctgggctcgggctgctctgtggggttcgactgtcgcccct
ggaccctttgtcacccggaggctgcagctgggccgctctggccctgcgtggcgagcccct
cggtcttcaaagcttcacctttctccgaaggcggacgtgaagaacttgatttcttacgtg
gtgaccaagacaagagcgattaacggatcgtaccatcgtttcttggggcgtcatttcccc
cgcttctatgccttatacacaaccttcatgaaaggaatacagatgttatgggctgatggc
aaaaaggctagaagaataaaggcagacatgtggaaacaaaacctaaagtttcatcaactc
tcttaccgggagatggagcatttgagacagttccgacgagatatcaccaagtgtctcttc
gttggcctcatctccattccaccctttgccaactacctggtctttttgctaatgtacctg
tttcctaggcaactgctagtcaagcatttctggacccccaaacaacaaattgatttcttg
gacgtttatcatggtctccggaggcggtcccactcggaagtcatcacacatctaagaagg
gccagcacttttgtttctcatgagaaactccggaggcagctgacagacctgtgcaccaag
gtgcagagtggcacccacccagcagcacaggacgtcctggctctcagagattgcttctct
acctaccccttgggcttcagccagctccaagcctcgcagatgagagccttgagccaggcc
atgctcctcacaccttacctgcccccgcccttgctgaggcagcggctaaagagtcacacc
accgtgatccaccagctggacagggctctggcaaagctggggattggccagctgactgca
caggaagtgaaatcggcttgctatcttcgtggcttgaactctacccacattgctgacgac
aggtgtcgagcctggctgggggaatggttgcacatctcctgtagcctgaaagaacccgag
ctgtccctcttgctgcacaacgtggtcctgctctccaccaactaccttgagacaaggcgc
tga

DBGET integrated database retrieval system