KEGG   Mus musculus (mouse): 68617
Entry
68617             CDS       T01002                                 

Gene name
Mtcl1, 1110012J17Rik, Ccdc165, D130071O13, Kiaa0802, So, Soga2, mKIAA0802, t8219b25
Definition
(RefSeq) microtubule crosslinking factor 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: SOGA DUF4482 RSS_P20
Other DBs
NCBI-GeneID: 68617
NCBI-ProteinID: NP_766551
MGI: 1915867
Ensembl: ENSMUSG00000052105
Vega: OTTMUSG00000033967
UniProt: Q3UHU5
Position
17; 17 E1.1
AA seq 1945 aa
METLNGPAGGGAPDTKPQPAGQHHRHHHLHPLAERRRLHRAPSPARPFLKDLHTRPATAT
PSAGRAPTPAAPRSPSLAGKAPPSPGPPAAPGRLSRRSGVVPGAKDKPPPGAGARSAGGA
KAVPGTRRAARAGPAEPLSRVGRPTGAEPPPAVAKGRKTKRGPGTPPARAVVPPARASRV
PAVTLSVTSVAGCRINHTDSSSDLSDCASEPLSDEQRLLPAASSDAESGTGSSDREPIRG
APTPSSGSRGPPPGSPEPPILLAAPPVASACLGGRSSPGGASTGSPGPGSQEDVGGRAPP
ERTILGTSKEPSLGEQPRLLVVAEEEELLREMEELRSENDYLKDELDELRAEMEEMRDSY
LEEDGYQLQELRRELDRANKNCRILQYRLRKAEQKSLKVAETGQVDGELIRSLEQDLKVA
KDVSVRLHHELETVEEKRAKAEDDNETLRQQMIEVEVSRQALQNEVERLRESSLKRRGSR
EMYKEKKLVNQDDSADLKCQLQFVKEEASLMRKKMAKLGREKDELEQELQKYKSLYGDVD
SPLPTGEAGGPPSTREAELKLRLKLVEEEASILGRKIVELEVENRGLKAEMEDIRVQHER
EGTGRDHVPSTPTSPFGDSMESSTELRRHLQFVEEEAELLRRSISEIEDHNRQLTHELSK
FKFEPHQESGWLGDGVSKGPAASVPLQEELKSARLQIDELSGKVLKLQCENRLLLSNAQR
GDLAAHLGLRAPSPRDSDAESDAGKKESDGEEGRLPQPKREGPVGGESDSEDMFEKTSGF
GSGKPSEASEPCPAELLRVREDTECLVTIKLEAQRLERTVERLISDTDGFIHDSGLRGNG
LASPGVQGGGGEGNSPSEPHLLETINVRMKAFRKELQAFLEQMSRIVDGLSPLSHLTESS
SFLSTVTSVSRDSPIGTLGKELGPDLQSKLREQLEWQLNQDRGDEREGLRLRATRELHRR
ADGDSGSHHGLGGQSCFNLEMEEDHLYALRWKELEMHSLALQNTLHKRTWSDEKNLLQQE
LRSLKQNIFLFYVKLRWLLKHWRQGKQMEEGGEDLEESEHPENVPGLAELGVQGVHQTDG
IDQEDADQGCSLPMGEHAPHSLVQISEHGSRLQSSDGGPLNKQVVENQQLFRALKALLED
FRSELREDEHARLRLQQQYASDKAAWDVEWAVLKCRLEQLEEKTEKSLGELDSSAEGKGA
LKKEREVHQKLLADSHSLVMDLRWQIHHREKNWNREKVELLERLDSERQEWGRQKEELLW
RVEQLQKEKSPRRSGSFLCSRREDDTRPYPHQGSLHSSRPVSMWPCEDADSIPFEDRPLS
KLKESDRCSASENLYLDALSLDDDPGDPPPLRNCLAEEEESRKGNLQRAVSVSCMSEFQR
LMDVSPFLPEKGLPSAGSKEDVTPPLSPDDLKYIEEFHSNDWDYASPRAEADRPPDPWAD
RTEMGRVGHEATTEPCPDPSWYLTTSVTMTTDTMTSPEHCQKQPLRTHVLTEQSGVHVLH
SPPAIRRVDSIASGGEGRSRADPEGPFPMSRARGNLADAKGGHPEPVLNRWPCTPPRHPR
DCVEGSLRPLDRPICPSLGFASPLNSLDMSKNMSDDMKEVAFSVRNAICAGPAEPHVRDM
ACQTNGSRTAGTQTIQTISVGLQTEALRASGVTSSPHKCLTPKAGGGTTPVSSPSRSLRS
RQVAPAIEKVQAKFERTCCSPKYGSPKLQRKPLSKADQPNSRTSPGIPQKGFSESAWARS
TTTRESPVHTTINDGLSSLFNIIDHSPIGVRAGSRSRSAEPRQELGPGQETGTSSRGRSP
SPLGVGSETFREEGGESTPVRQDLSAPPGYTLTENVARILNKKLLEHALKEERKQASHGS
SGLTSDSHTGEPVPAEPGSMEELPCSALAPSLEPCFSRPERPANRRLPSRWAPPSPTASQ
SQSPGHPMSMEEHGEEDPPEEKPHL
NT seq 5838 nt   +upstreamnt  +downstreamnt
atggagacgctgaacggccccgcgggcggcggcgccccggacaccaagccgcagccagcc
ggccagcatcaccgccaccaccacctgcacccgctggccgagaggaggcggctgcaccgc
gcaccctcgcccgccagacccttcctcaaggacctgcacacgcggcccgccacggccacc
ccctctgcgggccgtgccccgactcccgcggctcctcgctcgcctagccttgccgggaag
gcgccgccgtcgcccgggcccccggccgcgcccggtcgcctctcccgacgcagcggtgta
gtccccggcgcgaaggacaagccgccgccgggcgccggagccaggtcggcgggcggcgct
aaggccgtcccggggaccaggagggcggcgcgcgcggggccggcggagccactgtcccgg
gttgggaggccgactggggccgagccaccgcctgccgtcgcgaagggtcgcaaaaccaag
cgcggccccgggacgcctccagctcgcgccgtcgtgcccccggctcgcgcctcccgggtc
cccgccgtgaccctctctgtgacctcggtggctggctgtcgtatcaaccacacggacagc
agctcggatctctccgactgcgcctccgaacccttgtctgatgagcagcgcctactcccc
gccgccagcagcgacgctgagtcgggcaccggctccagtgaccgggaacccatacgcgga
gcacccactccgagctccggatcccgcgggccgccgccgggcagccccgagccccctatc
ctgctcgcggcgccccctgtcgccagtgcctgtctcgggggccgaagcagcccaggcggg
gcctccacagggtccccgggacccggttctcaggaggatgttgggggccgagcgccaccg
gagcggacgattctggggacctccaaggagcctagcctgggcgaacagccccggctcttg
gtggtggctgaggaagaggagttgctgagggagatggaggaactgcgctcggagaacgac
tacctcaaggacgagctggatgagctccgtgcagagatggaggagatgagggatagctat
ctggaggaggacgggtaccagctgcaggagctccggagagagctggaccgtgctaacaag
aactgcagaatcctgcagtaccgactcaggaaagccgagcagaagagcctgaaagtggcg
gaaacagggcaggtggacggggagctcatcagaagcctggagcaggacttgaaggtagcc
aaagatgtgtctgtcagattacaccacgaactcgagaccgtggaggagaagcgcgctaag
gctgaagacgacaacgaaacgctccggcagcagatgatcgaggtggaggtatccagacag
gccctccagaatgaggtggagagactgagggagagttctctgaagagaagaggcagtcgg
gaaatgtacaaagagaagaaacttgttaaccaggatgacagtgcggatttgaagtgtcag
cttcagtttgtcaaagaggaagcttccctgatgcgcaaaaagatggccaagttggggcgg
gagaaggacgagttggagcaggaactgcagaagtataagtccctctatggtgatgtggac
agtcccctcccaacaggggaggctggtggtccccccagcaccagggaggcagagctgaaa
ctgcggctgaagttggtggaggaggaagccagcatcttgggcaggaagatcgtggagctg
gaggtggaaaaccgtggcctcaaagcagagatggaagacatacgggttcagcatgaacgc
gagggaacaggcagggaccacgtgccaagcactcctacctcacccttcggagactcaatg
gagtcctccacggagctccgccggcacctgcagtttgtggaagaagaggctgagctgctg
aggagatccatctctgagattgaagatcacaaccggcagttgacccacgagctgagcaag
ttcaagtttgagcctcaccaggagtcagggtggcttggggacggtgtgtctaagggcccc
gcggccagcgttcccctgcaggaggagctgaagtcagccaggctacagatcgatgagctg
agcgggaaggtactgaagctgcagtgtgagaaccggctgcttctgtccaatgcccaacgg
ggtgacctcgccgcacatctggggctgcgcgctcctagcccccgggacagtgatgccgag
agtgacgcgggcaagaaagagagcgatggggaggagggccgccttccccagccaaagcga
gaaggccctgttggtggggagagcgactcggaggacatgtttgagaagacctcgggcttc
ggaagcggaaagccgtcggaggctagtgagccatgcccggcagagctgctaagggtccgg
gaggataccgagtgcctggtgaccataaagctggaggctcagcggcttgagcggactgtg
gagcgcctcatctctgatacagatggtttcatccacgactcaggactgcggggcaatgga
ttggcctcacctggagtccaaggcggaggaggtgagggcaacagcccgagtgagccccac
ttgttggagaccatcaatgtgaggatgaaggctttcaggaaagagctgcaggccttcctg
gagcagatgtcccggattgtggatggtctctcgcccttatcccacctcacagagtcatcc
agcttcctctccactgtgacttctgtgtcccgggactcccccatcgggaccctgggaaag
gagttgggcccagacttgcagtccaaactgagagagcagctggaatggcagctcaatcag
gatcgaggggacgagcgagagggcctgcgtctccgagccactcgggagctgcaccggcgc
gcggatggggattccgggagccaccatgggctgggaggccagagctgtttcaacctagag
atggaggaggaccacctctacgccctgcggtggaaggaactggagatgcacagcctggcc
ctgcagaacacccttcacaagcggacgtggagcgacgagaagaatctgctgcagcaggag
ctcaggtccctgaagcagaacatcttcctcttctacgtcaagctcaggtggctgctgaaa
cactggcgccaagggaagcagatggaggagggaggagaggatctggaggagagcgaacat
ccagagaatgtgcctgggcttgctgagcttggagtccagggggttcaccagacagatggg
atagaccaggaggatgctgaccaaggctgtagccttcccatgggagagcatgccccacac
tccctggtacagatcagcgaacacggatcacggctacagagttcagacgggggaccactt
aacaaacaggtggtggaaaaccagcagctcttcagggccctcaaggctctgctggaggac
ttccgttcggagctgcgcgaagacgagcatgcgcggctgcggctgcagcagcagtacgcc
agcgacaaggctgcgtgggatgtggagtgggctgtgctcaagtgccgcctggaacagctg
gaagagaagactgagaaaagcttgggcgagctggactcctctgctgagggcaaaggggcc
ttgaagaaggagagagaggtgcaccagaaactgctggctgacagccacagcctggtgatg
gacctgcgctggcagatccatcaccgagagaagaactggaaccgggagaaggtggagctg
ctggagcgtctggacagcgagcggcaggagtgggggcgacagaaggaggagctcctgtgg
cgggtggagcagttacagaaagagaaaagtccccggagaagcggcagtttcctctgcagc
cgaagggaagacgacacacgcccttacccgcaccaaggaagccttcactcctccagacct
gtgtccatgtggccctgtgaagacgccgactccatcccatttgaagaccggccgctctcc
aaactgaaggagtcggacaggtgctcggccagtgagaacctgtacttggacgctttgtcc
ctggatgatgatccaggggatccgccacccctcaggaactgccttgccgaggaagaagaa
agtcgcaagggcaatcttcagagggctgtgtctgtgtcctgtatgtccgagttccagcgt
ctgatggacgtctctccgttcctgcctgagaaggggctaccttccgccggcagcaaggag
gatgtcactccacccttgtctcccgacgacttgaaatacattgaagaattccatagcaac
gactgggattacgcatcccccagggctgaggccgatcggcctccagacccctgggcagac
aggaccgagatggggagggtggggcatgaagccaccacagagccttgtccggatccctcc
tggtatctgaccacaagtgtcacgatgacgacagacaccatgaccagtccggagcactgc
cagaagcagccactgcggacccatgtcctcactgagcagtctggtgtgcacgtgctgcac
agcccgcctgccattcgccgggttgacagtatagcatcaggcggcgagggcaggagccga
gcggaccccgagggcccctttcctatgagcagagcaagagggaacctggcagatgccaag
gggggtcatccagaacctgtgctcaacaggtggccttgcacgccacccagacatccccgg
gactgtgtggaggggtctcttcgccccctcgacagacctatctgcccctccctgggattt
gcctcccctctgaacagcctagatatgtctaagaacatgagtgatgacatgaaggaggtg
gctttttctgtcaggaatgccatctgcgccggtcctgccgagccacacgtcagggatatg
gcctgccagaccaatgggtccaggacagcagggacgcagaccatccagacaatcagcgtg
ggcctgcagaccgaggccctacgtgccagcggcgtcaccagcagcccccacaagtgtctc
acgccaaaagccggaggtggcaccacacccgtgtcttctccttcccgcagccttaggagt
agacaggtggcccctgccattgagaaggtgcaggccaagtttgaacgcacctgctgctcc
ccaaagtacggttctcccaaacttcagagaaagcccctctcaaaagctgaccagccaaat
agcaggacctcaccaggcataccccagaaagggttcagcgagtcagcctgggcccgctcc
accaccacgagggagagccctgtgcacaccaccatcaatgatggcctctccagcctcttc
aatatcatcgaccacagtcccatcggggtgcgggctgggagccgatctcggtcagcagaa
cctcgacaggagctgggtccaggccaggaaacgggcaccagttccagagggaggtcgccc
agcccgctaggggtaggctccgagacgttcagggaggagggaggagagagcacgccagtg
agacaggacttatctgcgccccctggctacacgctcactgagaatgtggcccggatcctc
aacaaaaagttgttggagcatgccttaaaggaggagaggaagcaagccagccatggctcc
tcaggtctcaccagcgacagccacactggagaaccagtgccagccgagccaggatccatg
gaggaactgccttgttctgcgctcgcgccctccctagagccctgcttttccaggccagag
agaccagcaaaccgccgccttccatcccgttgggccccaccttcccccactgcctcacag
tcacagtcacccggacacccgatgtccatggaggaacacggtgaggaggacccaccagag
gagaagccacacctgtga

DBGET integrated database retrieval system