KEGG   Mus musculus (mouse): 68618Help
Entry
68618             CDS       T01002                                 

Gene name
1110012L19Rik
Definition
(RefSeq) RIKEN cDNA 1110012L19 gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: ASCH
Motif
Other DBs
NCBI-GeneID: 68618
NCBI-ProteinID: NP_081063
MGI: 1915868
Ensembl: ENSMUSG00000045237
Vega: OTTMUSG00000017762
UniProt: Q9D1F3
Position
X; X A7.2
AA seq 157 aa AA seqDB search
MKFPCLSFRQPYAGLILNGVKTLETRWRPLLSSVQKYTIAIHIAHKDWEDDEWQEVLMER
LGMTWTQIQTLLQAGEKYGRGVIAGLIDIGETFQCPETLTAEEAVELETQAVLTNLQLKY
LTQVSNPRWLLEPIPRKGGKDIFQVDIPEHLIPLEKE
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttccctgcctatccttccggcagccctacgctggtttaatcttaaatggagtc
aagactcttgagacacgttggcgtcccctgttgagcagcgttcagaaatacaccattgcc
atccacattgctcacaaggactgggaagatgatgaatggcaggaagtgctcatggagagg
ttggggatgacctggacacagattcagaccttactacaggcaggagaaaagtacggcaga
ggcgtgatagctggacttattgacattggagagacttttcagtgtccagagaccttaact
gctgaggaggctgtggaactggaaactcaagctgtgctaaccaatctgcagctgaagtac
ctgactcaagtttcaaaccccaggtggttactggagcccatacctaggaaagggggaaag
gatatattccaggtagacatcccagagcacttgatcccactggagaaagaatga

DBGET integrated database retrieval system