KEGG   Mus musculus (mouse): 68625
Entry
68625             CDS       T01002                                 

Symbol
Cfap57, 1110020C03Rik, AV009650, C130004B06Rik, Gm1363, Wdr6, Wdr65
Name
(RefSeq) cilia and flagella associated protein 57
  KO
K24729  cilia- and flagella-associated protein 57
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    68625 (Cfap57)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 WD40 repeat (WDR) domain-containing proteins
  Cilia and flagella associated proteins
   68625 (Cfap57)
SSDB
Motif
Pfam: WD40 ATG16 YabA Turandot FUSC
Other DBs
NCBI-GeneID: 68625
NCBI-ProteinID: NP_081065
MGI: 2686209
Ensembl: ENSMUSG00000028730
Vega: OTTMUSG00000008826
UniProt: Q9D180
Position
4; 4 D2.1
AA seq 1249 aa
MSTVVAQALHVFGLRPHVTNNVFFFDEQIIIFPSGNHCVKYNIDQKWQKFIAGSDKSQGM
LALAISPNRRYLAISETVQEKPAVTIYELSSIPCRKRKVLNNFDFQVQKFTSMAFSPDSK
YLLTQTSPPDSNLVYWLWEKQKVMAIIKADSQNNPIYQVSISSQDNSQVCITGSGVFKLL
RFAEGTLKQINFQRGESSNYLAHAWVSEDRVIVGTDTGKLFLFESGDQRWETSIMVKEST
SSRSLEVIQESESLIEFPPLSSPVSSVERMDITTNTQQQAMPQVFAIAAYSKGFACSAGP
GRVLLFEKVEEKDFYRESREIRIPTDQQSNDPSQSDKQDVLCLCFSPSEETLIASTNKNQ
LYSITMSLTEISKGEAAHFEYLLYPLHSASITGLDTCIRKPLIATCSLDRSVRIWNYESN
TLELYKEYQEEAYTVSLHPSGHYIVVGFADKLRLMNLLIDDIRPFKEYSVRGCKECSFSN
GGHLFAAVNGNVIHIFTTTSLENINILKGHTGKIRSLVWNLDDSKLVSAGTDGAVYEWNL
STGKRETECVLKSCSYNSVTTSPDAKVIFAVGSDQTLKEISDSLILREIPAFDVIYTSIT
ISHSGRMIFVGTSVGTIRAMKYPLSLQKEYNEYQAHAGPVMKMLLTFDDQFLLTVGEDGC
LFTWKVFDKDGRGIKREREVGFAEEVLVTKTDMEEKAQIMLELKTRVEELKMENEYQLRL
KDMNYTEKIKELTDKFIQEMESLKTKNQVLKTEKEKQDISHRERLEELVDKQTRELQDLE
CCNNQKLLLEYEKYQELQLKSQRMQEEYEKQLRDNDETKSQALEELTEFYEAKLQEKTGL
LEEAQEDVRQQLREFEETKKQIEEDEDREIQDIKTKYERKLRDEKESNLRLKGETGIMRK
KFSSLQKEIEERTNDIELLKSEQMKLQGIIRSLEKDIQGLKREIQERDETIQDKEKRIYD
LKKKNQELEKFKFVLDYKIKELKKQIEPRENEIKVMKEQIQEMEAELERFHKQNTQLELN
ITELLQKLRATDQEMRKEQQKERDLEALVRRFKTDLHNCVAYIQEPGLLKEKIRGLFEKY
VQRADMVEIAGLNSDLQQEYARQREHLERNLATLKKKVIKEGELHRTDYVRIMQENVSLI
KEINELRRELKLTRSQIYDLESALKVSKKTRSQEVPESVISKDVVGSTSTMRLNEQEETG
RIIEMQRLEIRRLRDQIQEQEQVPGFHTIAGVRLPSIVDSDVDFEVHTK
NT seq 3750 nt   +upstreamnt  +downstreamnt
atgtccaccgtggtagctcaggcgcttcatgtttttggtcttcggcctcacgtgaccaac
aatgtcttcttcttcgatgaacagatcattatatttccttcaggaaatcactgtgtgaag
tacaatatagatcagaaatggcaaaaattcattgcaggctcagacaagagtcagggcatg
ctggctttggccatcagtcccaatcggcgatatctcgctatctccgagactgtgcaagaa
aaaccggccgtcactatttatgaactctcatccatcccttgccggaagcgcaaagtcctg
aataattttgatttccaagttcaaaagtttaccagcatggctttttctccagactctaaa
tacctgctgacacagacgtcacctccagactcaaacctcgtctattggctgtgggaaaag
cagaaagtcatggccattattaaagctgatagtcaaaacaaccccatctaccaggttagc
atcagttcccaggataatagtcaagtgtgtattactggaagtggggtatttaaacttctc
cgctttgctgaaggaaccctaaagcaaatcaatttccagaggggagaatcttcaaactac
ctagcccacgcctgggtgtctgaagacagggtcattgttggcactgacaccggcaaactc
ttcctctttgaatctggagatcagcgctgggagacaagcataatggtcaaggagtctact
agctccaggagcctggaggtcattcaagagtcagagagcctgatagagtttcccccactc
agctccccggtctcctccgttgaaaggatggatataaccactaacacccaacaacaggcc
atgccccaggtgtttgccatcgcagcctattcaaagggatttgcctgctctgcggggcct
ggaagagtgctgctgtttgagaaagtggaagagaaggacttttaccgggaaagcagggaa
atccggatccccacagaccaacaaagcaatgacccaagtcagtcagacaagcaggatgtc
ctgtgcctgtgcttcagcccatcagaagaaaccctgatcgccagcaccaacaagaaccag
ctctactccatcaccatgtccctgacggagatcagcaagggagaggctgcccacttcgag
tacctgctgtacccattgcactcagcatccatcactggtctcgatacctgcatccgaaaa
cccctcattgccacctgctctctggatcgctccgtccgcatctggaattacgaatcaaac
acactggagctatataaggaataccaagaagaggcctacacagtgagccttcacccctct
ggacactacattgtggtagggtttgctgacaaactgcgccttatgaatctgctcattgat
gacatccgtcctttcaaagaatattctgtcagagggtgcaaagagtgctcctttagcaat
ggaggtcacctgtttgctgcagtcaacggaaatgtgattcacatcttcaccaccacgagc
ctggagaacatcaatattttgaaaggccacacagggaagatccgttcactcgtgtggaac
ttagatgacagcaaactggtttctgctggaacagatggtgctgtgtatgaatggaatctg
tccacagggaagagagagacggagtgtgtgcttaagtcctgtagctacaactcggtcacc
acctcccctgatgccaaagttatctttgctgtcggatcagaccagactctcaaggagatt
tcagattctttgatcctccgagagataccagcatttgacgtcatctacacgtccatcacc
atctcacattctgggcgcatgatatttgtgggcacttccgtggggactatccgtgccatg
aagtacccgctgtctttgcagaaagaatacaatgagtaccaggctcatgctggccctgtc
atgaagatgctgctcacctttgacgaccagttcctgctgacagttggtgaggatggctgc
ctgttcacctggaaggtctttgataaggatggccggggaatcaaacgagagagggaggtg
ggctttgctgaagaggtgctcgtgactaagacagacatggaagagaaggctcagattatg
ctggagctgaagactcgtgtagaggaactgaagatggagaatgagtatcagctccggctg
aaggacatgaactacacggagaagatcaaggagctgacggacaagttcatccaggagatg
gaatccttaaagacgaagaaccaggtgttaaaaacagagaaagaaaaacaggacatcagt
caccgagagcgcttagaggaactcgtagacaaacagacccgggagctgcaagacctggaa
tgctgtaacaaccagaagctgctccttgaatatgagaagtaccaagagctgcagctcaag
tcccagaggatgcaggaggagtacgaaaagcagctccgggataacgatgagacgaagagc
caagccctggaggagctgaccgagttctatgaggccaaactccaggagaaaactggcctt
ctagaggaggcacaggaagatgtccgacagcagcttcgggaattcgaggaaaccaagaag
cagattgaagaagatgaagacagggagatccaagacatcaaaaccaagtacgagaggaag
cttagggatgagaaggagtctaaccttcgactcaagggagaaacgggcatcatgaggaag
aagttcagcagcctgcagaaggagatcgaagagcgcaccaacgacatcgagctcctcaag
tcggagcagatgaagctgcagggcatcatcagatccctggagaaagacatccaagggctc
aagagagagatccaggagagggacgagaccattcaagacaaggagaagcgaatttatgat
ctgaagaagaagaaccaagagctggagaaattcaagtttgtccttgactacaaaataaag
gagctgaagaagcaaatagaaccgagggagaacgagatcaaagtgatgaaagagcagatc
caggagatggaagccgagctggagcgtttccataaacagaacacgcaactggagctgaac
atcacagaactgttgcagaaactgcgagctacggatcaggagatgcgcaaggagcagcag
aaggaacgggatctggaagcgctggtccgacgcttcaagacagaccttcacaactgcgtg
gcgtacatccaggaacccgggctgctgaaggagaagatccgtggcctctttgagaagtac
gtgcagcgggcagacatggtggagattgcagggttgaactcagacctgcaacaggagtac
gcccgccagcgggaacacctggagaggaaccttgccacgctcaagaagaaagtgatcaag
gagggtgagctgcatcgcaccgactatgtccgcatcatgcaggaaaatgtctctctgatc
aaagaaattaatgagctccgcagggagctgaagttaacccgctcccaaatctatgacctt
gaatcggccctgaaagtatccaagaagacgcgctcacaagaagttccagagtcagtgata
agcaaggacgtagtcggcagcacctctactatgaggctgaacgaacaggaggaaaccggg
agaatcatcgagatgcaacgtctggaaatccgccgcctcagagaccagatccaagagcag
gagcaggtcccaggcttccacaccattgccggagttcggcttccttccatcgtcgactca
gatgtggattttgaagtgcacaccaagtga

DBGET integrated database retrieval system