KEGG   Mus musculus (mouse): 68626
Entry
68626             CDS       T01002                                 

Gene name
Elac2, 1110017O07Rik, D11Wsu80e, Hpc2
Definition
(RefSeq) elaC ribonuclease Z 2
  KO
K00784  ribonuclease Z [EC:3.1.26.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    68626 (Elac2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    68626 (Elac2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.11  tRNase Z
     68626 (Elac2)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  3'processing and CCA adding factors
   3'processing factors
    68626 (Elac2)
 Prokaryotic type
    68626 (Elac2)
SSDB
Motif
Pfam: Lactamase_B_4 Lactamase_B_2 Lactamase_B zf_CopZ
Other DBs
NCBI-GeneID: 68626
NCBI-ProteinID: NP_075968
MGI: 1890496
Ensembl: ENSMUSG00000020549
Vega: OTTMUSG00000005902
UniProt: Q80Y81 Q3U0M8
Position
11 B3; 11 40.42 cM
AA seq 831 aa
MWALRSLLRPLGLRTMSQGSARRPRPSKDPLRHLRTREKRGPGPGGPNTVYLQVVAAGGR
DAGAALYVFSEYNRYLFNCGEGVQRLMQEHKLKVARLDNIFLTRMHWSNVGGLCGMILTL
KETGLPKCVLSGPPQLEKYLEAIKIFSGPLKGIELAVRPHSAPEYKDETMTVYQVPIHSE
RRCGKQQPSQSPRTSPNRLSPKQSSDSGSAENGQCPPEDSSAGANRKAWGRDPSLVVAFV
CKLHLRKGNFLVLKAKELGLPVGTAAIAPIIAAVKDGKSITYEGREIAAEELCTPPDPGL
VFIVVECPDEGFILPICENDTFKRYQAEADAPVALVVHIAPESVLIDSRYQQWMERFGPD
TQHLILNENCPSVHNLRSHKIQTQLSLIHPDIFPQLTSFYSKEEGSTLSVPTVRGECLLK
YQLRPKREWQRDTTLDCNTDEFIAEALELPSFQESVEEYRKNVQENPAPAEKRSQYPEIV
FLGTGSAIPMKIRNVSSTLVNLSPDKSVLLDCGEGTFGQLCRHYGQQIDRVLCSLTAVFV
SHLHADHHTGLLNILLQREHALASLGKPFQPLLVVAPTQLRAWLQQYHNHCQEILHHVSM
IPAKCLQKGAEVSNTTLERLISLLLETCDLEEFQTCLVRHCKHAFGCALVHSSGWKVVYS
GDTMPCEALVQMGKDATLLIHEATLEDGLEEEAVEKTHSTTSQAINVGMRMNAEFIMLNH
FSQRYAKIPLFSPDFNEKVGIAFDHMKVCFGDFPTVPKLIPPLKALFAGDIEEMVERREK
RELRLVRAALLTQQADSPEDREPQQKRAHTDEPHSPQSKKESVANTLGARV
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgtgggcgctccgctcactgttgcgtccccttggcctgcgcaccatgtcgcagggttcg
gctcgtcggccgcggccatccaaagacccactgcgacacctgcgtacgcgggagaagcgc
ggcccgggtcccgggggcccgaacaccgtgtacctgcaggtggtggcggcgggcggccgg
gacgcgggggctgctctctatgtcttctcggaatacaacaggtacctttttaactgcgga
gaaggcgtccaacgacttatgcaggaacacaaactgaaagtcgctcgcttggacaacatc
tttctgactcggatgcattggtcaaatgttggggggttgtgtggaatgattttaacttta
aaggaaaccgggcttcccaaatgtgttctgtctggaccaccacagctggagaaatatcta
gaagcaatcaaaatattttctggtccattgaaaggaatagaactggccgtgcggcctcac
tctgcaccagaatacaaggatgagaccatgactgtttaccaggtccctatccacagtgaa
cggaggtgtggaaagcaacagccatcccagagccccagaacatctcccaacaggctcagt
cccaaacagtcatcggactctggatcagctgaaaatgggcagtgccctccagaggacagc
agtgcaggtgccaacaggaaagcatggggcagggacccctccttagtggtagcttttgtc
tgcaagcttcacttgaggaaaggaaacttcttggtgcttaaagcaaaggagctgggcctt
cctgttgggacggccgccattgcacccatcattgctgctgtcaaggacgggaagagtatc
acttacgaaggaagagagattgctgctgaagagctttgtacacccccagatcctggtctt
gtattcattgtggtagagtgtcctgatgaaggattcatcctgcccatctgtgagaacgac
acctttaaaaggtaccaggcagaggctgatgcacctgtggcgctggtggtccacatagcc
ccagaatctgtactcatcgacagcagataccagcagtggatggagaggttcgggcctgac
acacagcacctgattctgaatgagaattgcccctcggtccacaacctgcgcagccacaag
attcagacccagctcagcctcatccaccctgacatcttcccccagcttaccagcttctat
agtaaggaggaagggtccaccctcagcgtgccaacagttcggggtgaatgcctcctcaag
tatcagctccgccccaagagagagtggcagagggataccacactcgactgcaatactgat
gaattcatagctgaggccttggagctccccagtttccaggagagtgtggaggagtatcgg
aagaacgtgcaggaaaacccagccccagcagagaaaagaagccagtatcctgaaattgtc
ttcctgggtacggggtctgccatcccaatgaagatccgaaatgtcagttccacactcgtc
aacctaagccctgacaagtcagtgctcctggattgtggagaaggcacttttgggcagttg
tgccgtcattacggacagcaaatagaccgagtcttatgcagcctcacggctgtgtttgtg
tcccacctgcacgccgaccaccacacgggcttgctgaatatcttgctgcagagagagcat
gcgttggcatctctggggaaacccttccagcccttgcttgtggtggctcctacccagctc
agggcctggctgcagcagtatcacaaccactgccaggagattctgcaccacgtcagtatg
attcctgccaaatgccttcagaaaggggcagaggtctccaatactacattggaaaggctg
ataagcttgctgttggaaacatgtgacttagaagaatttcagacctgcctggtacggcac
tgcaagcatgcttttggctgtgcactggtacattcatctggctggaaagtcgtctactcg
ggggataccatgccctgtgaggctctggtccagatggggaaagatgccaccctcctgata
catgaagccactctggaggatggcttggaagaggaagcagtagagaagacacacagcacc
acctcccaggctattaatgtggggatgcggatgaatgcggagttcatcatgctgaaccac
ttcagtcagcggtacgccaagatcccccttttcagccctgacttcaacgagaaagttggc
atcgcctttgaccacatgaaggtctgctttggagacttcccgacagtgcccaagctgatt
cccccactgaaggccctgtttgcaggtgacattgaagagatggtggaacgcagggagaag
agggagctacggctggtgcgagcagccctcctgacccagcaggcagacagcccagaggac
agagaaccccaacagaagcgggcccacacagatgaaccacacagcccacagagcaagaag
gagagcgtggcaaacactttaggagcgcgagtgtga

DBGET integrated database retrieval system