KEGG   Mus musculus (mouse): 68646
Entry
68646             CDS       T01002                                 

Symbol
Nadk2, MNA, MNADK, Nadk, Nadkd1
Name
(RefSeq) NAD kinase 2, mitochondrial
  KO
K00858  NAD+ kinase [EC:2.7.1.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00760  Nicotinate and nicotinamide metabolism
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    68646 (Nadk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     68646 (Nadk2)
SSDB
Motif
Pfam: NAD_kinase DAGK_cat TPALS
Other DBs
NCBI-GeneID: 68646
NCBI-ProteinID: NP_001078879
MGI: 1915896
Ensembl: ENSMUSG00000022253
UniProt: Q8C5H8
Position
15; 15 A1
AA seq 452 aa
MTCYRGFLLGSCRRVAGGRAALRGSGSGADGRRHLGHGQPRELAGGGSPADGGFRPSRVV
VVAKTTRYEFEQQRYRYAELSEEDLKQLLALKGSSYSGLLERHHIHTKNVEHIIDSLRDE
GIEVRLVKRREYDEETVRWADAVIAAGGDGTMLLAASKVLDRLKPVIGVNTDPERSEGHL
CLPVRYTHSFPEALRRFSRGEFRWLWRQRIRLYLEGTGINPTPVDLHEQQLSLNQHSRAF
NIERAHDERSEASGPQLLPVRALNEVFIGESLSSRMPYCWAVAVDNLRRDIPNLKGLASY
YEISVDDGPWEKQKSSGLNLCTGTGSKAWSFNINRVAAQAVEDVLHIARRQGNLTLPLNK
DLVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMV
VDGGTSFEFNDGAIASMMINKEDELRTVILEQ
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgacttgctaccggggcttcctgctgggcagctgccggcgcgtggcgggtggccgcgcg
gctctgcggggttcgggctcgggcgcggacggccggcggcacttggggcacgggcagccg
cgcgagctggcgggcggtggtagccccgccgacggcggcttccgcccctcgcgggtggtg
gtggtggcgaaaaccacccgctacgagttcgagcagcagcggtaccgctacgcggagctc
tcggaggaggacctgaagcagctgcttgcattgaaaggctcgagctacagtggactactt
gagcgacatcatattcacaccaaaaatgtagaacacataattgatagtttacgggatgaa
gggattgaggttcgcctggtcaagcggagggagtacgatgaagagacagttcgatgggca
gacgctgtcatagctgcgggaggtgatggcacgatgcttctggctgcgagtaaagtcctg
gacagacttaaacctgtcattggggtcaacactgatccggaacggtctgaaggtcactta
tgtctgcctgtgcgatacacgcattccttccctgaagccttacggaggttctctcgtggt
gagttcaggtggttgtggaggcagcggatcaggttatatctggaagggactggcataaac
cccactcccgtggaccttcacgaacagcagctgagcttgaatcagcacagccgagccttt
aacatcgaaagagcgcacgatgaaaggtcggaggcgtcagggcctcagcttctgccggtg
agagcgctcaatgaagtcttcattggggagagcctgtcatccagaatgccttattgttgg
gctgtagcagtggacaatttaagaagagatatacccaatctaaagggactggcttcctac
tatgaaatttcagtcgatgacggcccatgggagaagcagaagagctcagggctcaatttg
tgcactgggacaggatcgaaggcctggtcattcaatattaacagggttgcagcgcaggct
gttgaagatgttttacatattgcaagacgacaaggaaatctgactcttccattgaacaaa
gacttggtagaaaaagtgacaaacgaatataacgaatcattgctctacagtccagaagaa
ccaaaaatacttttcagtattcgagagccaatagcaaacagagttttctccagcagccgt
cagcgttgtttctcttccaaagtttgtgttcgttctcgatgttgggatgcctgcatggtt
gtggatggaggaacgtcttttgagtttaacgacggagcaattgcttcaatgatgatcaat
aaagaagatgagcttcgaactgtgattctagagcagtga

DBGET integrated database retrieval system