KEGG   Mus musculus (mouse): 68652
Entry
68652             CDS       T01002                                 

Gene name
Tab2, 1110030N06Rik, A530078N03Rik, Map3k, Map3k7ip2, mKIAA0733
Definition
(RefSeq) TGF-beta activated kinase 1/MAP3K7 binding protein 2
  KO
K04404  TAK1-binding protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu05132  Salmonella infection
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05161  Hepatitis B
mmu05162  Measles
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    68652 (Tab2)
   04064 NF-kappa B signaling pathway
    68652 (Tab2)
   04668 TNF signaling pathway
    68652 (Tab2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    68652 (Tab2)
   04621 NOD-like receptor signaling pathway
    68652 (Tab2)
   04657 IL-17 signaling pathway
    68652 (Tab2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    68652 (Tab2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    68652 (Tab2)
   05161 Hepatitis B
    68652 (Tab2)
   05171 Coronavirus disease - COVID-19
    68652 (Tab2)
   05162 Measles
    68652 (Tab2)
   05168 Herpes simplex virus 1 infection
    68652 (Tab2)
   05169 Epstein-Barr virus infection
    68652 (Tab2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    68652 (Tab2)
   05135 Yersinia infection
    68652 (Tab2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    68652 (Tab2)
   05140 Leishmaniasis
    68652 (Tab2)
SSDB
Motif
Pfam: CUE zf-RanBP Spc29 DivIC
Other DBs
NCBI-GeneID: 68652
NCBI-ProteinID: NP_619608
MGI: 1915902
Ensembl: ENSMUSG00000015755
Vega: OTTMUSG00000034128
UniProt: Q99K90
Structure
PDB: 
3A9J

Position
10; 10 A1
AA seq 693 aa
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDESGISGLRNHMTSLNLDLQSQNVYHHGREGSRVNGSRTLTHSVSDGQLHGGQSNNE
LFQQEPQTAPAQVPQGFNVFGMPSTSGASNSTPHLGFHLGSKGTSNLSQQTPRFNPIMVT
LAPNIQTGRSTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPSGTARQTQQHSGWVSQFN
PMNPQQAYQPSQPGPWTTYPASNPLPHTSTQQPNQQGHQTSHVYMPISSPTTPQPPTIHS
SGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNSSSKLRSSGPRTASTSSLVNSQTL
NRNQPTVYIAASPPNTDEMISRSQPKVYISANATAGDEQGMRNQPTLFISTNSGPSAASR
NMSGQVSMGPAFIHHHPPKSRVLGGNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGV
VSPTFELTNLLNHPDHYVETENIQHLTDPALAHVDRISEARKLSMGSDDAAYTQALLVHQ
KARMERLQRELEMQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNR
QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSTIKAPKTQDA
EDEEGAQWNCTACTFLNHPALIRCEQCEMPRHF
NT seq 2082 nt   +upstreamnt  +downstreamnt
atggcccaaggaagccaccaaattgattttcaggttttacatgacctgcgacaaaaattc
ccagaagtgcctgaagttgttgtatccaggtgcatgttacagaacaataataacctggat
gcctgctgcgctgttctctctcaggagagtacaaggtatctttatggtgaaggagacctg
aatttttcagatgagtctggaatttctggtctacgcaatcacatgacttctctcaacttg
gacttgcagtcacagaatgtttaccaccatggaagagaaggaagtcgagtgaatggaagc
aggactttaacacacagcgttagtgatggacagcttcacggtgggcagtccaataacgaa
ctgtttcagcaagagccacagacagcaccagctcaagttcctcaaggctttaatgttttt
ggaatgcccagtacatctggtgcttcaaactcaacaccgcatcttggatttcacctaggc
agcaaagggacatcaaacctttctcaacagactcccaggttcaatcctattatggtaact
ttagccccaaacatacagactggccgtagtactcctacatctttgcacatacatggtgta
cctccgcctgtactgaacagtccacagggaaattctatctatattaggccttatattaca
actcctagtggtacagctcggcagacacaacaacattctggctgggtgtctcagtttaat
cccatgaaccctcagcaagcctatcaaccttcacagcctggaccttggactacttatcct
gcatccaatcctttgccacatacctcaacccagcagccgaatcagcagggccatcagacc
tctcatgtctacatgcctatcagttcgccaactactccacaaccgccaaccattcactca
tctgggagctctcagtcttctgcccatagccaatataacattcagaatatttcaacagga
cctcgaaagaaccagatagaaatcaaacttgaacccccacaaagaaacagttcttcaaaa
ttacgttcttctggacctcgaactgccagcacttcctcattggtcaacagccagacctta
aatagaaatcagcccactgtttacatagctgccagtcctccaaatactgatgagatgatc
tcccgtagtcaacccaaggtctatatttcagccaatgccaccgcaggagatgagcaaggc
atgcggaatcaaccgacactcttcatatctacaaactctgggccatctgcagcctccagg
aacatgtctgggcaagtgagcatgggtcctgcctttatccatcaccatccacccaaaagc
cgagtgttaggtggtaactctgcaacgtctcctcgagtggtggtcactcaacccaacaca
aaatatactttcaaaattacagtttcccccaataagccccctgctgtttccccgggggtg
gtctccccaacctttgaacttacaaatcttctaaatcatcctgaccattatgtagaaaca
gagaacattcagcatctcacagacccggctctagcacatgtggatagaataagcgaagcc
cggaaactgagtatgggatctgatgatgctgcctacacacaagctctgctggtgcaccag
aaggccaggatggaacggcttcaaagagagctcgagatgcaaaagaaaaagctggataaa
ctcaaatctgaggtcaatgagatggaaaataatctaactcgaaggcgcctgaagagatca
aattccatttcccagataccgtcactcgaagaaatgcagcagttgagaagttgtaataga
caactccagattgacattgactgcttaaccaaagaaattgatctttttcaagcccgagga
ccacattttaaccccagcgctattcataacttttatgacaatattggatttgtaggccct
gtgccaccaaaacccaaagatcaaaggtccaccatcaaagcaccaaagacccaagacgca
gaggatgaggaaggtgctcagtggaattgcactgcctgtacgtttctgaatcacccggcc
ttaatccgctgtgaacagtgtgagatgcctcggcatttctga

DBGET integrated database retrieval system