KEGG   Mus musculus (house mouse): 68655
Entry
68655             CDS       T01002                                 
Symbol
Fndc1, 1110027O12Rik, 1110051A18Rik, mKIAA1866
Name
(RefSeq) fibronectin type III domain containing 1
  KO
K24484  fibronectin type III domain-containing protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    68655 (Fndc1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type III domain-containing proteins
   68655 (Fndc1)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N Interfer-bind Tissue_fac
Other DBs
NCBI-GeneID: 68655
NCBI-ProteinID: NP_001074885
MGI: 1915905
Ensembl: ENSMUSG00000071984
UniProt: E9Q043
Position
17:complement(7957401..8046159)
AA seq 1781 aa
MAPEARASPRLLLRAALLLLAALLPVATSAGPPVDHPLKPRHVKLLSTNMGLKVTWDPPK
DASSRPVEYYNIAYGKSLKSLKSIKVNAETHSFLIKDVEKEVPNKPLRMRVRASDDRLSV
AWKAPRLSGAKSPRRSRGFLLGYGESGRKMNYVPLTRDERSHEIKKLASESVYVVSLQST
NSQGQSQPVYRAALTKRKHAEEDELDVPEDISVRVMSSQSVLVAWVDPLVEKQKRVVASR
QYTVRYREKGESARWDYKQVSNRRVLVDSLIPDTVYEFAVRISQGERDGKWSASIFQRTP
ESAPTTAPENLRVWPVSGKPTVVTVSWDALPESEGKVKEYILSYAPALKPFGAKSLTFSG
HTTSALVDGLQPGERYLFKIRATNRRGPGPHSKAFIVAIPTTSSTEASAQPNGRDSSRKP
EKLQQPSSPAPKVAASSEHTPSAKNVKDALSDLNKIRTNSVVPGKTQLHSKMGELDPQST
EVTGEEELDSLEDPRSSRLETLNQKQPLRVPSRSGHGVLTPGRTPARTGLPVLPRKEVMD
RRGPSLDPHLRPRVEPSASSAYHQLSSIDNDSVDQNEYDQAGSPDPKAVSSPSSPKNPAR
SRLTSVPSRHAASNMLRDKSRMQPGTKASSSSASSQSHSSTSEEDSSAAAQPRSHSLLQG
GSSRPALSRDRQDVHASSSRMPSQTVSSSRPSALTEGSEEEDTSDGGADIDRAAGDTRRR
AEATAQIQQTRPALGHFSLIRNKPFPAHSRNPSRFPKLRGPRLQPSRSPQSTSASKVLTR
APSLPASHTRPGSDVYGDGEDEEPLPATVVNDRTPSSSSHPISGGSDTLRRGSQRGASLY
RKEPIPENSKAAGADVHPGGKSPLSSKAQGFQLSTDEGAPQTPPSSTSRQLSPARHPASR
SQPSPGSTVPRRMAPGRSSELSSSQSKDRSLSQPKLSLAHTGPDRPHAANSRGVLPSAPQ
NQNEGSQSSYEDNSTEIEGPDPRAPTHSAHAKDTTPSILKPQQMGSQSGNSGNRPQPSRS
GASERPIRPGSTHPRVQVPGRAGLQATPAKKISSSKHPLPPESQQSVFTEEEEENEGILK
GKEDSLSTSVKKWPSSSSPRNNKYADRNLDRDKAAIGQLVQEEDSIPGRRSPGSPPIASH
PPTWYQPRNPVTASPSASTHSWPRYTTRAPSTYSSTTPMLSLRQRMQRRFRTPVSRQPPP
RPVLTSGYNGRANVGENIPPGSIGKPNGQRIINGPQGTKWVVDLDRGLVLNAEGRYLQDS
HGNPLRVRLGGDGRTIVDLGGTPMVSPDGLPLFGQGRHGKPVASAQDKPILSLGGKPLVG
LEVIKTTTYSPTTTMLPTTTTTTVLTTTTRPPTTTTTTTRRTTTRRTTTTRHPTTTIRAT
RRTTTTTTTPEPTTPSPTCPPGTLEHQDEAGNLIMGSNGIPECYPEEDDFSGLETDTAPP
TEEDYVVYDDDYGFETTRPPTSTMPSTTAATPKVIPEQGTVSSFPEEEFDLAGKRRFVAP
YVTYLSKDPTAPCSLTDALDHFQVESLDELIPNDLTKSDLPPQHAPRNITVVAMEGCHSF
VIVDWNKAIPGDVVTGYLVYSASYEDFIRNKWSTQTSSVTHLPIENLKPNTRYYFKVQAK
NPHGYGPVSPSVSFVTESDNPLLVVRPPGGEPIWIPFAFKHDPGYTDCHGRQYVKRTWYK
KFVGVVLCNSLRYKIYLSDNLKDTFYSIGDSWGRGEDHCQFVDSHLDGRTGPQSYIEALP
NIQGYYRQYRQEPVSFGHIGFGTPYYYVGWYECGVSIPGKW
NT seq 5346 nt   +upstreamnt  +downstreamnt
atggcccccgaggccagggcgtccccgcgcctgctgctcagggcggcactgctgctcctg
gcggcgctgctaccggtggctacctcagcaggacccccagttgaccacccactgaagcca
aggcatgtgaaactgctgtccactaacatgggcctgaaggtcacatgggacccacccaaa
gatgcttccagtagaccggtggagtattacaacattgcctatgggaagtcactgaaaagt
cttaagtccatcaaggtgaatgcggagacacactccttccttattaaggacgtggaaaag
gaagtgcccaacaagcccttgcgtatgcgtgtccgagcctcagacgacaggctgtccgtt
gcatggaaggcgccacgcctgtctggagccaagagcccacgaagatctcggggttttctt
ctgggctacggggaaagtggccggaagatgaattatgtcccactgaccagagatgagaga
tcacatgaaattaaaaagctcgcctctgagtcggtgtatgtggtgtccctgcagtccacg
aactcccaggggcagagtcagcccgtctatagggctgccctcacaaagcgcaagcatgca
gaagaggatgagctggacgtgcctgaagacattagtgtccgggtcatgtcgtctcagtcc
gtgctcgtggcctgggtggatcctcttgtggaaaaacagaagagagttgttgcatcaaga
cagtacactgtgcgttaccgcgagaagggggagtcggccaggtgggattacaagcaagtc
tctaacaggcgtgtcctggtggacagcctgatcccagacaccgtgtatgaattcgcagtc
cggatttcacaaggtgaacgagatggcaagtggagtgcatccatcttccagagaacgcca
gaatcggctcccaccactgcacctgagaacctgagagtctggccagtcagtggcaagccc
acagttgtcaccgtatcctgggacgcattgccagagtctgaggggaaagtgaaagaatac
attctttcatacgccccggctctcaaaccgtttggagcaaagtccctcaccttctctgga
cacacgacttctgccctcgtggacggtctgcagcctggggaacgctatctgttcaaaatc
cgggccacaaacaggagaggcccggggccacactccaaagccttcattgtcgctatacca
acaaccagttctactgaggccagtgcccagccaaatgggagagacagcagcaggaaacct
gagaaactgcagcagccttcttccccagctcccaaagttgcagcttcctcagaacacacg
ccgtcagccaaaaatgtcaaggatgctctctcagacttgaacaaaatccgaactaatagt
gtggtacccgggaaaacccagcttcactctaaaatgggagagctggatccgcagtccaca
gaagtcactggcgaggaggaactggattcccttgaagatcctcgttcatcacggttggag
accctaaatcagaagcaacccttgagggtaccaagtagatctggtcatggggttctgact
cctggtaggactccagccaggactggcctgccagtgctgccccgcaaggaagtgatggac
aggcgtgggccctcattagacccccatcttcgtccaagggttgaaccttcagcttcttca
gcctaccaccagctcagctctatagacaatgattctgtggaccaaaatgagtatgatcaa
gcaggatcccctgaccctaaagctgtctcttccccgtcatctcccaagaatccagccagg
tccaggctaacttccgtccctagccgccatgcggcttctaacatgctcagagacaaaagc
cggatgcagccgggtacaaaggcatcatcatcatccgcatcgagccagtcccattcttcc
accagcgaggaagattccagcgctgcagcccaaccccggagccattccctactgcaggga
ggatcctctcgacccgcactttctagggatcgccaggatgtccatgcctctagttcccgt
atgccttcccaaactgtcagctcttctcgtccctctgccctgacagagggctccgaggaa
gaggacacttctgatggtggggcggatattgacagagctgcaggagacaccagaaggcga
gctgaggccactgctcagatccaacagacccggcctgccttggggcactttagtttgata
cggaataagcccttccctgcccacagcagaaatccaagcagattccccaaactccgcgga
ccaaggcttcagccctctaggtctccccagtctacctcagcctcgaaagtcctcaccagg
gctccttcgctgccagcatcccacactaggcctggctctgatgtctatggagatggtgag
gatgaagagccacttccagccactgtggtcaacgatcgtacaccttcctcttccagtcat
ccaatctctgggggctcagacactctgagaagaggctcccagagaggggccagcttgtac
cggaaggaacccatcccagaaaactccaaagctgctggagcggatgtacatccaggaggc
aaatcccctctgtcctccaaggctcagggctttcaactgagcacggatgagggtgctcct
caaacacctccatcatccaccagccgccagctgtcccctgctagacatccagcatcgaga
tcacagccctcccctgggtccactgttcccagaagaatggcaccaggtcgcagctcagag
ctctctagttctcagagcaaagataggtcactttcccagcccaagttgtctcttgctcac
accgggcctgaccgcccgcacgcagcaaactcccgtggggtgctcccctcggctccccag
aatcagaatgagggttcccagagcagctacgaggacaacagcactgaaattgaaggccca
gaccctcgggctcccactcactccgctcacgccaaggataccaccccatccattctcaaa
cctcagcagatgggctcccagtcagggaacagtggcaacagacctcagcccagccgttcg
ggagcctctgagagacccatccggcctggcagcacccacccacgggtccaggttcctggc
agggctgggctccaggccacaccagcaaagaagatctcgtcttccaagcatcctctgcca
cccgaatctcagcaatcagtcttcactgaggaggaagaggaaaatgaaggaattttaaaa
ggcaaggaagactctctgtctacctcagttaaaaagtggccttcttcctcctccccccgg
aacaacaaatatgcagacaggaaccttgacagagacaaggctgccattgggcaacttgta
caggaagaagacagcatccccggaaggcgatcaccaggcagccccccaatagcctcacat
ccacctacctggtaccagcctcgaaaccctgtcactgcaagtcccagcgcaagcacgcac
tcctggccaaggtataccacccgggccccttccacctactcttccacgacaccaatgctg
tctttgcggcagcggatgcagcgtaggttccggacgccagtctcccgccagcctccgccg
agaccagtgcttacatcaggttataatggaagggcaaatgttggcgagaacatacctcct
ggtagtattggaaaaccaaatggacagagaattatcaatggtcctcaaggaacaaagtgg
gttgtagacctggatcgcggcttggtgttgaatgcagaagggcggtacctgcaagactca
catggcaaccctctccgggtgagactcgggggagatggtcgcaccatcgtggatctggga
ggaacccctatggtgagtcctgatggcctccccctctttgggcaggggagacatggcaaa
cctgtggccagtgcccaggataaacccatcttgagtctcggagggaagcccttagtgggc
ttggaggtgatcaaaaccaccacatactctcctaccacaaccatgcttccaaccacaaca
accaccactgtgctgaccaccacaacccggccgcctacaaccacaaccaccaccacccgc
cgcacaaccacccgccgcacaaccactaccaggcatcccacaactacaattcgagctact
cgcaggacaacgaccactaccaccactccagaacctaccaccccttctcctacttgtccc
cctgggaccctggaacaccaggatgaagctggcaaccttataatgggctcaaatgggatt
ccagagtgctaccccgaggaagatgacttctcaggcctggagactgacactgcaccaccc
acagaagaggactatgttgtatacgatgacgattatggatttgagaccacaaggccaccg
accagcaccatgccctcaaccactgctgccacaccgaaggtcatcccagagcagggcacg
gtcagctccttcccagaggaagaatttgaccttgctggaaagaggagatttgttgctcct
tatgtcacatacctcagtaaagacccaacagccccgtgctccctgactgatgcgctggac
catttccaagtggaaagcctggatgaactcattccaaacgacctgacaaagagtgatctg
cctcctcagcacgctccccggaacattactgtggtcgccatggaaggctgccactccttt
gtcattgtggactggaacaaagccatccctggagatgtggtaacaggatacctggtctac
agcgcctcttatgaggacttcatccggaataaatggtcaactcagacctcgtcagtgacc
catctgcccattgagaacttgaagccaaacacaaggtattacttcaaagttcaagccaaa
aaccctcatggctatgggcctgtcagtccttcagtctcatttgttacagaatcagacaat
cctctgctggttgtgaggccaccaggtggtgagcccatctggatcccattcgctttcaag
catgatcctggctacactgattgccatggtcggcagtatgtgaaacgaacatggtacaaa
aagtttgtgggagtcgttctttgtaattctctaaggtataagatctacctcagtgacaat
ctcaaagacacattctacagcattggagacagctggggaagaggtgaagaccactgtcag
tttgtggattcgcacctggatggaagaacagggcctcaatcttatatagaagccctcccc
aacattcaaggctactatcgccagtaccgccaggagcctgtcagctttggacacattggt
tttggaaccccctattactatgtgggttggtacgaatgtggagtctccatcccagggaag
tggtaa

DBGET integrated database retrieval system