KEGG   Mus musculus (house mouse): 68673
Entry
68673             CDS       T01002                                 
Symbol
Krtap4-2, 1110033F04Rik, AI604442
Name
(RefSeq) keratin associated protein 4-2
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Keratin_B2_2 Keratin_B2
Other DBs
NCBI-GeneID: 68673
NCBI-ProteinID: NP_081083
MGI: 1915923
Ensembl: ENSMUSG00000044649
UniProt: B1AQ85
Position
11:complement(99524940..99525910)
AA seq 167 aa
MVSSCGSVCSEEGCGQGCCQPSCCQTTCCRTTCCRPSCCVSSCCRPSCCVSSCCRPSCCR
PQCCQSVCCQPTCCRPSCCISSCCQPSCGSSSCCGSSCCRPCCRPCCSPCCSPCCRPCCR
PCCRPCCRPCCCLRPVCGQVCCQTTCYRPTCVISTCPRPMCCAIPCC
NT seq 504 nt   +upstreamnt  +downstreamnt
atggtcagctcttgtggctctgtctgctctgaagagggctgtggccaaggctgctgccag
cccagctgctgccaaaccacctgctgtaggaccacctgctgccgccccagctgctgtgtg
tccagctgctgcaggcccagctgctgtgtgtccagctgctgcaggcccagttgctgcagg
ccccagtgctgccagtctgtgtgctgccagccgacctgctgccgccccagctgctgcatt
tccagctgctgtcaaccctcctgtggtagctccagctgctgtggttctagttgctgccgc
ccctgctgccgcccctgctgcagcccttgctgcagcccctgttgccgtccctgctgccga
ccctgctgccgcccctgttgccgcccctgctgctgtctgagaccagtctgtggtcaggtc
tgctgccaaaccacttgctaccgccccacctgtgtcatctccacctgcccccgccccatg
tgctgtgccatcccctgctgctaa

DBGET integrated database retrieval system