KEGG   Mus musculus (mouse): 68675
Entry
68675             CDS       T01002                                 

Symbol
Fam172a, 1110033M05Rik, 2610318O14Rik, 53-E6, 9430037D06Rik, AF064782, pEN, pEN87
Name
(RefSeq) family with sequence similarity 172, member A
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Arb2 Hydrolase_4 ATP-grasp_6 Abhydrolase_6
Other DBs
NCBI-GeneID: 68675
NCBI-ProteinID: NP_612185
MGI: 1915925
Ensembl: ENSMUSG00000064138
UniProt: Q3TNH5
Position
13; 13 C1
AA seq 417 aa
MSISLSSLIFLPIWINMAQMQQGGSNETEQTAALKDLLSRIDLDELMKKDEPPFDFPDTL
EGFEYAFNEKGQLRHIKTGEPFVFNYREDLHRWNQKRYEALGEIITRYVYELLESDCNLK
KISIPVDATESEPKSFIFMSEDALTNPQKLMVLIHGSGVVRAGQWARRLIINEDLDSGTQ
IPFIKRAMDEGYGVIVLNPNENYIEVEKQKMHKQSSSSDGTDEPAGKRERRDKVSKETKK
RRDFYEKYRNPQKEKEMMQLFIRENGSPEEHAVYVWDHFIAQAAAENVFFVAHSYGGLAF
VELMIQREADVKSKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVES
MLPDCPRVSAGTDRHELTSWKSFPSIFKFFAEASEAKSSSQKPALTRRSHRIKHEEL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtctatttccttgagctctttaattttcttgccaatttggataaacatggcacaaatg
cagcagggaggttcaaatgaaacagaacagactgcagcattgaaagatttgctgtctagg
atcgatttggatgaactcatgaaaaaggacgaaccaccttttgattttccagatacactg
gaaggctttgaatatgcttttaatgaaaaggggcagttaagacacataaaaactggggaa
ccatttgtttttaactaccgagaagacttacacaggtggaaccagaaaagatatgaagct
ctgggcgagatcatcacaagatatgtttatgagctcctggaaagtgactgtaatttgaaa
aaaatctctattccagtagatgccactgagagtgaaccaaagagttttatctttatgagt
gaggatgctttgacaaatccacagaaactgatggttttaattcatggtagtggtgttgtc
agggcaggtcagtgggctagaaggcttattattaatgaagatctggacagtggcacacag
ataccttttattaagagagctatggatgaagggtatggagtcatcgtcctgaacccaaat
gaaaactatatagaagtggaaaagcagaaaatgcataaacagtcatcatcttctgatggt
acagatgagccagcagggaagcgggaaaggagagataaggtctccaaggaaacaaagaag
cgtcgtgatttctatgagaagtaccgcaaccctcaaaaggagaaagaaatgatgcagttg
tttatcagggaaaatggttctcctgaagagcatgcggtctatgtgtgggaccatttcata
gcccaggctgctgctgagaatgtgttctttgtggctcatagctatggaggacttgctttt
gttgaactgatgattcaacgagaagcagatgtaaaaagtaaggtgactgctgtggcattg
acagactctgttcacaatgtgtggcatcaagaagctggcaaaaccatccgagaatggatg
agagagaactgttgtaactgggtctccagctcagaaccattagatacatcggtggaatcc
atgctgcctgactgtcccagagtgtctgcaggcaccgaccgtcacgagctcacttcctgg
aagagcttcccgtctatcttcaagttcttcgcggaagcctcggaggccaagagcagctcg
cagaagccggccctgacgcggcgctcgcaccggatcaagcacgaggagctgtga

DBGET integrated database retrieval system