KEGG   Mus musculus (mouse): 68678Help
Entry
68678             CDS       T01002                                 

Gene name
Smtnl1, 1110030K22Rik, CHASM
Definition
(RefSeq) smoothelin-like 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: CH CAMSAP_CH DUF3579
Motif
Other DBs
NCBI-GeneID: 68678
NCBI-ProteinID: NP_077192
MGI: 1915928
Ensembl: ENSMUSG00000027077
Vega: OTTMUSG00000013726
UniProt: Q99LM3
Structure
PDB: 

Position
2; 2 D
AA seq 459 aa AA seqDB search
MEQTEGNSSEDGTTVSPTAGNLETPGSQGIAEEVAEGTVGTSDKEGPSDWAEHLCKAASK
SGESGGSPGEASILDELKTDLQGEARGKDEAQGDLAEEKVGKEDTTAASQEDTGKKEETK
PEPNEVREKEEAMLASEKQKVDEKETNLESKEKSDVNDKAKPEPKEDAGAEVTVNEAETE
SQEEADVKDQAKPELPEVDGKETGSDTKELVEPESPTEEQEQGKENESEERAAVIPSSPE
EWPESPTDEGPSLSPDGLAPESTGETSPSASESSPSEVPGSPTEPQPSEKKKDRAPERRV
SAPSRPRGPRAQNRKAIMDKFGGAASGPTALFRNTKAAGAAIGGVKNMLLEWCRAMTRNY
EHVDIQNFSSSWSSGMAFCALIHKFFPEAFDYAELDPAKRRHNFTLAFSTAEKLADCAQL
LEVDDMVRLAVPDSKCVYTYIQELYRSLVQKGLVKTKKK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggagcagacagaagggaactcctctgaggatgggaccactgtctccccaactgcaggg
aatcttgagacaccaggaagtcaaggcattgcagaggaggtggccgaaggcacagttggg
acaagtgacaaagaagggccttcagattgggcagaacatttgtgtaaagcagcatctaag
agtggcgaatcaggggggtccccaggggaagcaagtatattagatgagctcaagacagac
ttgcaaggggaagccagagggaaggacgaagcccagggtgaccttgctgaggagaaggtt
gggaaggaagacaccacagcggcttctcaggaagacactggtaagaaagaagaaacaaaa
cctgaacccaatgaagttagggagaaagaggaggccatgctggcctcggagaagcagaag
gttgatgagaaagagaccaatctagaatctaaggagaaatcggatgtgaatgacaaagcc
aagcctgaacccaaggaggatgctggagcagaggttactgtcaacgaggctgagactgag
tctcaggaggaggctgatgtgaaggaccaggccaagcccgagcttccagaagttgatggg
aaagagaccggaagtgacacaaaggagttggtggagccagagagtcccactgaagagcaa
gagcagggtaaggaaaatgaatcagaagaaagggctgcagtgattcccagctcccccgag
gagtggcccgaaagccccacagatgaggggcccagcctcagcccagatggattggctcca
gagtctacaggagagaccagtccttcagccagtgaatcttcgcccagtgaggtgccaggg
agtcccacagagcctcaaccctcagagaaaaagaaggatcgagcaccagaacgcagagtg
tcggcacccagccggccccgggggccccgtgcacagaatcggaaggccatcatggacaaa
tttggcggggcagcctctggccccactgcactgttccggaacacaaaggcagccggggca
gccatcggtggtgtcaagaacatgcttttggagtggtgccgggccatgacgagaaactac
gagcacgtggatatccaaaacttctcctccagctggagcagcggcatggccttctgtgcc
ctcatccacaagttttttccagaagcctttgactatgcagagctggacccagcaaagcgc
cggcacaacttcaccctagctttctcgactgcagagaaactagccgactgtgcccagctg
ctggaggtggatgacatggtgcggctggcagtgcccgattccaagtgtgtctacacctac
atccaggagctataccgtagccttgtgcagaaagggctggtgaagacgaaaaagaaatga

DBGET integrated database retrieval system