KEGG   Mus musculus (mouse): 68703
Entry
68703             CDS       T01002                                 

Gene name
Rere, 1110033A15Rik, AI414665, ARG, ARP, ATN1L, AW742570, Atr2, DNB1, eye<m03Jus>, eyes3, mKIAA0458
Definition
(RefSeq) arginine glutamic acid dipeptide (RE) repeats
  KO
K05628  arginine-glutamic acid dipeptide repeats protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    68703 (Rere)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    68703 (Rere)
SSDB
Motif
Pfam: Atrophin-1 BAH ELM2 GATA Myb_DNA-binding
Other DBs
NCBI-GeneID: 68703
NCBI-ProteinID: NP_001078961
MGI: 2683486
Ensembl: ENSMUSG00000039852
Vega: OTTMUSG00000010393
UniProt: Q80TZ9
Position
4 E2; 4 81.34 cM
AA seq 1558 aa
MTADKDKDKDKEKDRDRDRDRERDKRDKARESENARPRRSCTLEGGAKNYAESDHSEDED
NDNNSATTEESNKKSRKKPPKKKSRYERTDTGEITSYITEDDVVYRPGDCVYIESRRPNT
PYFICSIQDFKLVHSSQACCRSPAPAFCDPPACSLPVAPQPPQHLSEAGRGPGGSKRDHL
LMNVKWYYRQSEVPDSVYQHLVQDRHNENDSGRELVITDPVIKNRELFISDYVDTYHAAA
LRGKCNISHFSDIFAAREFKARVDSFFYILGYNPETRRLNSTQGEIRVGPSHQAKLPDLQ
PFPSPDGDTVTQHEELVWMPGVSDCDLLMYLRAARSMAAFAGMCDGGSTEDGCVAASRDD
TTLNALNTLHESSYDAGKALQRLVKKPVPKLIEKCWTEDEVKRFVKGLRQYGKNFFRIRK
ELLPSKETGELITFYYYWKKTPEAASSRAHRRHRRQAVFRRIKTRTASTPVNTPSRPPSS
EFLDLSSASEDDFDSEDSEQELKGYACRHCFTTTSKDWHHGGRENILLCTDCRIHFKKYG
ELPPIEKPVDPPPFMFKPVKEEDDGLSGKHSMRTRRSRGSMSTLRSGRKKQPTSPDGRAS
PINEDIRSSGRNSPSAASTSSNDSKAETVKKSAKKVKEEAASPLKSTKRQREKVASDTED
TDRITSKKTKTQEISRPNSPSEGEGESSDSRSVNDEGSSDPKDIDQDNRSTSPSIPSPQD
NESDSDSSAQQQMLQAQPPALQAPSGAASAPSTAPPGTPQLPTQGPTPSATAVPPQGSPA
TSQPPNQTQSTVAPAAHTHIQQAPTLHPPRLPSPHPPLQPMTAPPSQSSAQPHPQPSLHS
QGPPGPHSLQTGPLLQHPGPPQPFGLPSQPSQGQGPLGPSPAAAHPHSTIQLPASQSALQ
PQQPPREQPLPPAPLAMPHIKPPPTTPIPQLPAPQAHKHPPHLSGPSPFSLNANLPPPPA
LKPLSSLSTHHPPSAHPPPLQLMPQSQPLPSSPAQPPGLTQSQSLPPPAASHPTTGLHQV
PSQSPFPQHPFVPGGPPPITPPSCPPTSTPPAGPSSSSQPPCSAAVSSGGSVPGAPSCPL
PAVQIKEEALDEAEEPESPPPPPRSPSPEPTVVDTPSHASQSARFYKHLDRGYNSCARTD
LYFMPLAGSKLAKKREEAIEKAKREAEQKAREEREREKEKEKEREREREREREAERAAKA
SSSAHEGRLSDPQLSGPGHMRPSFEPPPTTIAAVPPYIGPDTPALRTLSEYARPHVMSPT
NRNHPFYMPLNPTDPLLAYHMPGLYNVDPTIRERELREREIREREIRERELRERMKPGFE
VKPPELDPLHPATNPMEHFARHSALTIPPAAGPHPFASFHPGLNPLERERLALAGPQLRP
EMSYPDRLAAERIHAERMASLTSDPLARLQMFNVTPHHHQHSHIHSHLHLHQQDPLHQGS
AGPVHPLVDPLTAGPHLARFPYPPGTLPNPLLGQPPHEHEMLRHPVFGTPYPRDLPGAIP
PPMSAAHQLQAMHAQSAELQRLAMEQQWLHGHPHMHGGHLPSQEDYYSRLKKEGDKQL
NT seq 4677 nt   +upstreamnt  +downstreamnt
atgacagctgacaaagataaagacaaagacaaagagaaggaccgggaccgggatcgggac
cgagaaagagataaaagagacaaagcaagagagagcgagaatgccaggcctcgcaggagc
tgtaccttggagggaggagccaaaaactatgctgagagcgatcacagcgaggacgaagac
aacgacaacaacagcgccaccacggaggagtccaacaagaagagcagaaagaaacctccg
aaaaaaaagtcccgctacgagaggacagacactggtgagataacttcttacatcaccgag
gacgacgttgtctacagaccgggagactgtgtgtatatcgagagtcggcggccaaacaca
ccgtatttcatctgcagcatccaagacttcaaactggtccacagctcccaggcctgttgc
agatctccagctcctgctttctgtgaccccccagcatgctctctgccggtggcaccacag
ccaccacagcacctctctgaagccgggagagggcctggagggagtaagagggaccatcta
ctcatgaacgtcaaatggtactaccgtcagtctgaagtcccagattctgtctatcagcat
ttggttcaggatcggcataatgaaaacgactctggaagagagcttgtcatcacagatcca
gtcatcaagaatcgggaactcttcatttctgattatgttgacacctaccatgctgctgcc
ctaagagggaagtgtaacatctcccatttttctgacatatttgctgctcgagagtttaaa
gcccgagtggactcatttttctacatattaggatacaaccctgagacaaggcggctgaat
agtacccaaggggaaattcgagttggccctagccaccaggccaaacttccagatctgcaa
ccatttccttctccagatggtgatactgtgactcagcatgaggaacttgtctggatgcct
ggagtcagtgactgtgacctcctcatgtacttgagggcagcaaggagcatggcagcattt
gcagggatgtgtgatggaggctccacagaggatggctgtgttgcagcatctcgggatgac
accactctcaatgcactgaacacactacatgaaagcagttatgatgccggcaaagccctg
cagcgcctggtgaagaagcctgtgcccaagctgatcgagaagtgctggacagaggatgaa
gtgaaacgcttcgttaaggggctccgacaatacggcaagaacttcttcagaatcagaaag
gagctgcttcccagtaaggaaaccggggaactgattaccttctattactactggaagaaa
acaccagaggcggccagctcccgtgcccaccgccgccaccgcaggcaggcggtgttcaga
agaattaagactcgcacagcgtccacccctgtcaacacgccctccagaccaccttccagt
gaattcttggacctgagttcagctagtgaggatgactttgacagtgaggacagcgaacag
gagctgaaggggtacgcctgccgtcactgcttcaccaccacctccaaagactggcaccac
gggggccgggaaaacatcctactgtgcacggactgtcgcatccacttcaagaagtacggt
gagctgccacccatcgagaagcccgtggaccccccgcccttcatgttcaagcctgtcaag
gaggaggacgatgggctcagtgggaagcatagcatgaggacgcggcggagccggggctcg
atgtctacactacgcagtggtcggaagaagcagcccaccagtcctgatggtcgtgcctca
cccatcaatgaagacatccgatccagtggccggaactcccccagtgctgctagcacttcc
agcaatgacagtaaagcagagacagtgaagaagtcagccaagaaggtgaaggaagaggct
gcatcccctctgaagagcaccaagcgccagcgggagaaggtggcctctgacacagaagac
actgataggatcacctccaaaaagacaaagacccaggagattagccgtcccaactctccc
tctgaaggagagggggagagttcggacagtcgcagtgtcaacgatgagggcagcagtgac
ccgaaagacattgaccaggataatcgcagcacgtctcccagtatccccagccctcaggat
aatgagagtgactcggactcatcagcacagcagcagatgttgcaggcccagcccccagcc
ttgcaagctcccagtggtgctgcctcggctccctccacagcccctccaggaacaccccag
cttcccacccaaggacccacaccctctgccactgcagtccctccacagggctcccctgca
acctcacagccccctaaccagactcagtctacagttgcacctgcagcccacacccacatc
caacaggcacccaccctgcacccccctcggctgccctcacctcatcctccactgcagcct
atgactgcaccgcctagccagagctctgcacaacctcacccccagccctccttgcacagt
cagggcccgcctggccctcacagcctacagactggacccctgttacagcacccaggacct
cctcagccctttggacttccttcccagccctcccaaggtcagggccctctgggcccctcc
ccggcagcagctcatcctcatagcaccatacagcttccagcgtcgcagtcagcgctgcag
ccccaacagcccccaagggaacagcccttgcctcctgcccctttagctatgcctcacatc
aaacccccacccaccacaccaattccccagcttccagcaccacaagcccacaaacatccg
cctcacctctcaggcccctcccccttctctctgaatgccaatctgccacccccgccagcc
ctgaaacccctgagctcactgtccacacaccaccctccctcagcccaccctccaccctta
caactcatgcctcagagccagcccttgccctcttcacctgcccagccacctgggctgacc
cagagccagagcctaccacctcctgctgcctcccatcctaccactggcctccaccaggtg
ccctcccaatccccatttccccagcaccctttcgtacctggaggcccccctcccatcacc
ccgccctcctgcccccccacttccacccctcctgccgggcccagctcctcatcacagcca
ccctgctctgctgctgtgtcttctggaggcagtgttcctggggcgccatcttgcccactc
cctgctgtgcaaatcaaggaggaggctctggatgaagctgaggagccagagagccctcct
ccaccccccaggagcccatcccctgagcccactgtagtggacacccccagccatgccagc
cagtctgccaggttctacaaacacctggaccggggctacaactcgtgtgcacggacagac
ctgtacttcatgcctctggctggatccaaactagccaagaagagggaggaggccattgag
aaggccaagcgggaggctgaacagaaagcccgagaggaacgggagcgggagaaagagaag
gaaaaagagcgagaacgggagagagagcgggaacgggaggcagagcgcgctgctaaggca
tccagctctgcacatgaaggccgtcttagtgaccctcagctcagtggcccgggtcacatg
cgaccctccttcgagccaccaccgaccacaatcgctgctgtgcccccatatattgggcct
gacacacctgccctccggacactgagcgaatatgctcggcctcatgtcatgtctcccacc
aaccgcaaccaccccttctacatgccccttaatcccaccgaccccctgctggcctaccac
atgcctggcttgtacaatgttgatcccaccatccgcgagcgggagctccgagagcgcgag
atcagagagcgcgagatccgggagcgggaattgcgggagaggatgaagccaggctttgag
gtgaagcccccagagctggaccccctgcacccagccaccaaccccatggagcattttgcc
cggcacagcgccctcaccatccctcctgcagctggcccccacccctttgcctctttccac
ccgggcctcaaccctttggagcgggagagactggcactagcaggtcctcagctgcggcct
gagatgagttacccagacagactggcagccgagcgcatccatgctgagcgtatggcatca
ctcaccagcgaccccctggcacgactgcagatgtttaatgtcactccacaccatcaccag
cattcacacatccactcccacctccacctccaccagcaggatcctctccaccaaggttca
gcaggcccagttcaccccctggttgaccccttgactgctggccctcacttagctcgcttc
ccctatcccccgggcaccctccctaaccctctacttggacagccccctcacgagcacgag
atgctgcgccacccagtttttggcaccccctatccccgagacctgcctggggctattcca
ccccccatgtcagcagcccaccagcttcaggccatgcatgcccagtcagccgagctacag
agactagccatggagcagcagtggctgcacggacatccacacatgcatggtggccatctg
ccaagtcaggaggattattacagtcgactgaagaaagaaggtgacaagcagttataa

DBGET integrated database retrieval system