KEGG   Mus musculus (house mouse): 68735
Entry
68735             CDS       T01002                                 
Symbol
Mrps18c, 1110037D14Rik
Name
(RefSeq) mitochondrial ribosomal protein S18C
  KO
K02963  small subunit ribosomal protein S18
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    68735 (Mrps18c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    68735 (Mrps18c)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    68735 (Mrps18c)
  Bacteria
    68735 (Mrps18c)
SSDB
Motif
Pfam: Ribosomal_S18 Cript
Other DBs
NCBI-GeneID: 68735
NCBI-ProteinID: NP_081102
MGI: 1915985
Ensembl: ENSMUSG00000016833
UniProt: Q8R2L5
Position
5:100946625..100952333
AA seq 143 aa
MAALVALCSGIGRKNLTTAAGCFTDRGTQAVSVIWRRCFSQFEQVTSNEDLPVPMENPYK
EPLKKCVLCEKRVDYKNVQLLSQFISPFTGCIYGRHITGLCGKKQREITKAIKRAQKMGF
MPVTYKDPAYLKDPRVCNIRYRE
NT seq 432 nt   +upstreamnt  +downstreamnt
atggccgctctggttgctctgtgcagtggtatagggaggaagaatttgacaaccgcggct
ggctgcttcacggatcgcggaactcaagcagtttctgtgatttggagacgatgtttttca
cagtttgaacaggtaaccagcaatgaggacctgccagtcccaatggagaacccctacaag
gagcctcttaagaagtgtgtcttgtgtgagaaacgtgtagattacaagaatgtgcagctt
ttgtcccagtttatttctccatttaccggatgcatttatggaaggcacataacaggtctt
tgtggaaagaaacagagggaaataactaaagccattaagagagctcagaaaatggggttt
atgccagttacatacaaggatcctgcatatctcaaagaccctagagtttgtaacatcaga
taccgagaataa

DBGET integrated database retrieval system