KEGG   Mus musculus (mouse): 68743Help
Entry
68743             CDS       T01002                                 

Gene name
Anln, 1110037A17Rik, 2900037I21Rik, C78101, Scraps
Definition
(RefSeq) anillin, actin binding protein
  KO
K18621  actin-binding protein anillin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    68743 (Anln)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     68743 (Anln)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Anillin_N Anillin PH
Motif
Other DBs
NCBI-GeneID: 68743
NCBI-ProteinID: NP_082666
MGI: 1920174
Ensembl: ENSMUSG00000036777
Vega: OTTMUSG00000062373
UniProt: Q8K298
Position
9; 9 A3
AA seq 1121 aa AA seqDB search
MDPFTEKLLERTRARRENLQRKMAERPTAVARSAPHAKRGREPLSEASNQQQPLPGGEEK
SCTKPSPSKKRCSDKIEVGAPDLENTEPIDVAKPCSPMPAPRQAKPPAPAAISESVAAPA
ALLSADRGLNSGSEASATSSVKTRMQRLAEQRRHWDSDLTDDVSESSYFAPVPTEDKAAS
PSKPPISNASATPVGRRGRLANLAATICSWEDDVSHSSAKQNSVQEQPGTACLSKSSSAS
GASASINSSSVQQEATCCSPRDGNASVRKDPSSNAAHGPLLSASVSSSVKASSPVTAATF
ITENREAQNPELLHKTASPLKTEARKPCEKPTLSQGAQPKEEANREVCLQSQSKDKLATP
GGRGIKPFLERFGERCQEHSKESPSYRASHKTPNITPNTKAIQERLFKQNTCSSTTHLAQ
QLKQEREKELACLRGRLDKGNLWSAEKNEKSRSKHLETKQEVHCQNTPLKKHQTVASTPL
TSVTDKVAENEPAVKLSSTEPAGSTESEMTKSSPLKITLFLEEEKSLKVASDLEVEQNTE
AVREVEMSVDDEDINSSRVINDIFSDVLEEGELDVEKSQEEMDQVGAENSEEQEDALNIS
SMSLLAPLAQTVGVVSLENVISSPPSELRDSNLSAASPKPGKFQRTRVPRAESADSLGSE
DRDLLYSIDAYRSQRFKETERPSIKQVIVRKEDVTSKLGEKKNVFSGQVNIKQKMQELNN
DINLQQTVIYQASQALNCCVDEEHGKGSLEEAEAERLLLIATEKRALLIDELNKLKSEGP
QRRNKTSVISQSEFAPSKGSVTLSEICLPLKADFVCSTAQKTDASNYYYLIMLKAGAEQM
VATPLASTANSLSGDALTFPTTFTLHDVSNDFEINIEVYSLVQKKDSLGPDKKKKASKSK
AITPKRLLTSITSKSSLHSSVMASPGGLGAVRTSNFTLVGSHTLSLSSVGDTKFALDKVP
FLSPLEGHICLKISCQVNSAVEEKGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYPDDE
RRKNPIGRINLANCISHQIEPANREFCARRNTLELITVRPQREDDRETLVSQCRDTLCVT
KNWLSADTKEERDLWMQKLNQVIVDIRLWQPDACYKPVGKP
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atggacccgtttaccgagaagttgctagaacgaactcgtgccagacgagagaatcttcag
agaaaaatggctgagaggcctacggcagtagcgagatctgccccgcatgcgaagagaggc
agagagccactttcagaagcaagtaatcagcagcagcccctaccagggggcgaagaaaaa
tcttgtacaaaaccatcaccatcaaaaaaacgttgttctgacaaaattgaagtgggagct
ccggacttagaaaatacagaacctattgatgttgcaaagccctgttctccgatgcctgca
ccccggcaggcgaagcccccagcaccagctgccatcagcgagtctgtggctgccccagca
gccctgctcagcgcggacagagggctgaactcaggatccgaagcatctgcaacctcctca
gttaaaactcgaatgcaaaggcttgctgagcagcggcgccattgggatagtgatctcaca
gatgatgtatcagaaagttcatactttgcaccagtgccaactgaggacaaggctgcctca
ccttctaagccacccatttcaaatgcctcagctactccagttgggagaaggggccgtctg
gccaaccttgctgcaacgatttgctcctgggaagatgatgtaagccactcatctgcaaag
caaaatagtgtgcaagaacagcctggtaccgcttgtttatccaaatcttcctctgcaagt
ggagcatctgctagcatcaatagcagcagtgttcagcaggaagctacatgctgttcccca
agggacggcaatgcctctgtcaggaaagacccatcttcaaatgctgcccatggacctttg
cttagcgcctcagtgtccagctctgtgaaagcgtcttcccctgtgacagctgctaccttc
atcactgaaaaccgtgaggcacaaaatcctgagctacttcacaaaactgctagtcctctg
aaaacagaggcgcggaaaccatgtgagaagccaactttgtcccagggagctcagcccaaa
gaggaggctaacagagaagtttgtctacagtcacaatccaaggacaaacttgcaacacca
ggaggaagaggaattaagcctttcctggaacgctttggagagcgttgtcaagaacacagt
aaagaaagtccgtcttatagagcatctcataaaaccccaaatatcactccaaatacaaaa
gccatccaggaaagattattcaaacaaaacacatgctcgtctactacccatttagcacag
cagctcaaacaggaacgtgaaaaagaactggcatgtcttcgtggtcgacttgacaagggc
aatttatggagtgcagaaaagaatgaaaagtcaagaagcaagcatctagaaaccaaacag
gaagttcactgtcagaacactccactcaagaaacatcaaactgtcgcaagcaccccattg
acttctgtaacagataaggtggctgaaaatgaaccagcagtgaagctttctagcacagag
cctgcaggttccactgaaagcgaaatgacaaagtccagccctttgaaaatcacgttgttt
ttagaagaagaaaaatccttaaaagtagcatcagacctggaggttgagcagaacactgaa
gcagtgcgtgaggttgagatgagtgtggacgatgaggacatcaatagctccagagtcatt
aacgacatcttcagtgacgtcctagaggaaggggagctggatgtggaaaagagccaagag
gagatggaccaagtgggagcagaaaacagtgaggagcaggaagatgcgctcaatatctct
tcaatgtctttacttgctccgctagctcagacggtcggtgtggtgagcctagagaatgta
atttcttcacctccgtcggaattgagagactctaacctaagcgctgcaagtcctaagccc
gggaaattccagagaacccgcgtccctcgcgccgaatctgccgatagcctcggttctgag
gaccgggaccttctctatagcattgatgcatataggtctcaaagattcaaagaaacagaa
cgcccttccataaagcaagtgattgttcgaaaggaagatgttacttcaaagttgggtgaa
aagaaaaacgtattttctggtcaagttaatatcaaacaaaaaatgcaggagctcaataat
gacataaatttgcagcagacagtgatctatcaggccagtcaggctctcaactgctgtgtg
gatgaagaacacgggaaaggatccttggaagaagctgaagcagaaagacttcttctgatt
gcaactgagaaaagagcacttctgattgatgagctgaataagctgaagagtgaaggacct
cagaggagaaacaagaccagtgtcatatcccagagtgaatttgctccatctaaagggtca
gtcactctgtcagaaatctgcttgcctctgaaggcagattttgtctgcagcactgcgcaa
aaaacagatgcatcaaattattactacttaattatgctaaaagctggggctgagcagatg
gtcgccactccattagcaagtactgcaaactctctcagtggtgacgctctgacatttcct
actacatttactctgcatgatgtttccaatgactttgaaataaacattgaagtttacagc
ctggtacaaaagaaagattccttgggccccgataagaagaagaaagcctccaagtccaag
gctattactccaaagagactcctcacatctataacttcaaaaagcagccttcattcttca
gttatggccagtcccggaggtctcggtgctgtgcgtaccagcaactttaccctagttgga
tctcacacactctccttatcttctgttggagacactaagtttgctttggacaaggtacct
tttttgtctccgttggaaggtcacatctgtttaaaaataagctgtcaagtgaattcagct
gttgaggaaaagggtttccttaccatatttgaagatgttagtggctttggtgcctggcac
cgaagatggtgtgttctctctggcaactgtatctcttactggacttacccagatgatgag
aggcgaaagaatcccataggaaggataaatctggccaattgtatcagtcatcagatagaa
ccagccaacagagaattttgtgcaagacgcaacactctggaattgattactgtccgacca
caaagagaagacgatcgagaaactcttgtcagccaatgtagagacacactctgtgtcacc
aagaactggctctctgcagatactaaagaagagcgggatctctggatgcagaaactcaac
caggtcattgttgatattcgcctctggcagcctgatgcatgctacaagcctgttgggaag
ccttaa

DBGET integrated database retrieval system