KEGG   Mus musculus (mouse): 68767Help
Entry
68767             CDS       T01002                                 

Gene name
Washc1, 1110049F14Rik, ORF19, Wash, Wash1
Definition
(RefSeq) WASH complex subunit 1
  KO
K18461  WAS protein family homolog 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    68767 (Washc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    68767 (Washc1)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Others
   WASH complex
    68767 (Washc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WASH_WAHD
Motif
Other DBs
NCBI-GeneID: 68767
NCBI-ProteinID: NP_001032846
MGI: 1916017
Ensembl: ENSMUSG00000024101
UniProt: Q8VDD8
Position
17; 17 E1.1
AA seq 475 aa AA seqDB search
MTPVKTQCSLAGQLYAVPLIQPDLRREEAIQQVADALQYLQNISGDIFSRISRRVELSRR
QLQAISERVSLAQAKIEKIKGSKKAIKVFSSAKYPAPEHLQEYGSIFTGALDPGLQRRPR
YRIQSKHRPLDERALQEKLKYFPVCVNTKSEPEDEAEEGLGGLPSNISSISSLLLFNTTE
NLYKKYVFLDPLAGAVTKTHTMLGTEEEKLFDAPLSISKREQLERQAPENYFYVPDLGQV
PEIDVPSYLPDLPGVADDLMYSADLGPGIAPSAPGAIPELPAFHTEVAEPLQPELENEVL
LAAPPPPPPPPPPPPPAPTALVSTPQPPMFPDMATAAGQVAREEDSSSSMAHTASVQGAP
KEVVDPSSGRATLLESIRQAGGIGKAKLRSVKERKLEKKKQKEQEQVRATSQGGDLMSDL
FNKLVMRRKGISGKGPSTGTSEGPGGAFSRMSDSIPPLPPPQQPAGDEDEEDWES
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggtgaagacccagtgctccttggcgggccagctttatgcagtgcccctcatc
cagcccgacctgcgacgagaggaggcaatccagcaagtggcagatgccctgcagtaccta
cagaacatctctggagacatcttcagcaggatctcccgacgagtagagctgagtcggcgc
cagctgcaggccattagtgagagggtctccttggcccaggctaagatagagaagatcaag
ggcagtaagaaggccatcaaggtcttttctagtgccaagtacccagcaccagagcacctg
caggaatacggctccatctttactggcgccttggaccctggtctgcagagaagaccccgt
tacaggatccagagcaagcaccgcccactggatgagcgggctctgcaggagaagctgaaa
tactttcccgtgtgtgtgaacaccaagtcggagcctgaggatgaagctgaggagggactt
gggggtcttcccagcaacatcagctccatcagctccctgctgctcttcaacaccacagag
aatctgtataagaagtatgttttcctggaccctctggctggtgcagtaacaaaaacgcac
acgatgctgggcacagaggaggagaaattgttcgatgcccctctgtctatcagcaagaga
gagcagctggagcggcaggctccagaaaactacttctacgtgccagacctgggccaggtt
cctgagatcgacgtgccatcctacctacccgatttacccggcgtcgcagacgacctgatg
tacagtgcggatttgggccctggcattgccccgtctgctcctggtgctatcccagagttg
cctgccttccacacagaggtggcagaacctctccagccagagctagagaatgaagtactg
ttggcagcaccgcccccgcctcctcccccaccgccgccacctcccccagctcccacagca
ttggtcagtaccccacagccaccgatgttccctgacatggcaactgctgctggccaggtt
gccagggaagaagactctagcagcagcatggcccacacagcctctgttcagggagcccct
aaggaggtggttgacccctccagtggccgggccactctgctcgagtccatccgccaagct
gggggcattggcaaggccaagctacgcagcgtgaaggagcgcaaactggagaagaagaaa
cagaaggagcaggagcaagtgagagccacgagccaaggtggggacttgatgtcagatctc
ttcaacaaacttgtcatgaggcgcaaaggtatctctggaaagggacctagcactggaacc
agtgagggacctggaggagccttctctcgaatgtcagactccatcccaccgctgccaccc
ccacagcagccggcaggagacgaggatgaggaggactgggagtcctaa

DBGET integrated database retrieval system