KEGG   Mus musculus (mouse): 68799
Entry
68799             CDS       T01002                                 

Gene name
Rgmb, 1110059F19Rik, DR, DRAGON
Definition
(RefSeq) repulsive guidance molecule family member B
  KO
K06847  RGM domain family member B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    68799 (Rgmb)
SSDB
Motif
Pfam: RGM_C RGM_N
Other DBs
NCBI-GeneID: 68799
NCBI-ProteinID: NP_848730
MGI: 1916049
Ensembl: ENSMUSG00000048027
UniProt: Q7TQ33
Position
17; 17 A2
AA seq 436 aa
MGVRAAPSCAAAPAAAGAEQSRRPGLWPPSPPPPLLLLLLLSLGLLHAGDCQQPTQCRIQ
KCTTDFVALTAHLNSAADGFDSEFCKALRAYAGCTQRTSKACRGNLVYHSAVLGISDLMS
QRNCSKDGPTSSTNPEVTHDPCNYHSHGGVREHGGGDQRPPNYLFCGLFGDPHLRTFKDH
FQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSATATNKVTIIFKAQHECTDQKVYQAVTD
DLPAAFVDGTTSGGDGDVKSLHIVEKESGRYVEMHARYIGTTVFVRQLGRYLTLAIRMPE
DLAMSYEESQDLQLCVNGCPMSECIDDGQGQVSAILGHSLPHTTSVQAWPGYTLETASTQ
CHEKMPVKDIYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPRKERWHIFPSSCGGCRD
LPVGLGLTCLILIMFL
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgggcgtgagagcagcaccttcctgcgccgccgcccccgccgccgccggggctgagcag
tcccgccgccccgggctctggccgccgtcgcccccgccgccgctgttgctgctgctgctg
ctcagccttgggctgctccacgcaggtgattgccaacagcctactcaatgccgaatccag
aaatgtaccacagacttcgtggccctgactgcacacctgaactctgccgctgatgggttt
gactctgagttttgcaaggcacttcgcgcctatgctggctgcacccagcgaacttcaaag
gcctgccgaggcaacctggtgtaccattctgctgtgttaggcatcagtgatctcatgagc
cagaggaactgttccaaggatggacccacatcttccaccaatccggaagtgacccatgac
ccctgtaactaccacagccacgggggagtcagagaacatgggggaggggaccagagacct
cccaattaccttttctgtggcttgtttggagaccctcaccttcgaactttcaaggatcac
ttccagacatgcaaagtggaaggggcctggccactcatagacaacaattacctttcggtt
caagtgacgaacgtgcctgtggtccccgggtccagtgcaactgctacaaacaaggtcacg
attatcttcaaagcacagcacgagtgcacggatcagaaggtgtaccaagctgtgacagat
gacctgccggccgcctttgtagatggcaccaccagtgggggggacggtgacgtgaagagt
cttcacatcgtggagaaggagagtggccgctacgtagagatgcatgcccgctacataggc
accacagtgtttgtgcgacagctgggtcgctacctaaccctcgctatccggatgcccgaa
gacttggccatgtcctatgaggaaagccaggacttgcagctgtgtgtgaatggctgcccc
atgagtgaatgcattgatgatggacaaggccaggtgtctgctatcctggggcacagcctg
cctcacaccacctcagtgcaggcctggcctggctacacactggagactgccagcacccaa
tgccacgagaagatgccggtgaaggacatctatttccaatcgtgtgtcttcgacctgctc
accactggtgatgccaactttactgctgcagcccacagtgccttggaggatgtggaagcg
ctgcacccaagaaaggaacgctggcacatcttccccagcagctgtgggggatgtagggat
ttgcctgttggtcttggactcacatgcttgatccttattatgtttttgtag

DBGET integrated database retrieval system