KEGG   Mus musculus (house mouse): 68818
Entry
68818             CDS       T01002                                 
Symbol
Zfand2b, 1110060O18Rik, C81256
Name
(RefSeq) zinc finger, AN1 type domain 2B
  KO
K24685  AN1-type zinc finger protein 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    68818 (Zfand2b)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Zinc finger domain-containing proteins
  AN1-type zinc finger domain-containing proteins
   68818 (Zfand2b)
SSDB
Motif
Pfam: zf-AN1 UIM Transp_Tc5_C
Other DBs
NCBI-GeneID: 68818
NCBI-ProteinID: NP_001153377
MGI: 1916068
Ensembl: ENSMUSG00000026197
UniProt: Q91X58
Structure
Position
1:75145290..75148270
AA seq 257 aa
MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLC
NVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERSGCRQREMMKLTCDRCGR
NFCIKHRHPLDHECSGEGHQTSRAGLAAISRAQGLASTSTAPSPSRTLPSSSSPSRATPQ
LPTRTASPVIALQNGLSEDEALQRALELSLAEAKPQVLSSQEEDDLALAQALSASEAEYQ
QQQAQSRSLKPSNCSLC
NT seq 774 nt   +upstreamnt  +downstreamnt
atggagtttccggacctcggggctcactgttccgagccgagctgtcagcgcttggatttt
ttgccactcaagtgcgatgcctgctcgggcatcttctgcgcagaccatgtggcctacgcc
cagcatcactgtggatcagcttaccaaaaggatatccaggtacctgtgtgccctctctgt
aatgtgcctgtgccggtggccagaggagagcctcctgaccgtgctgtgggagagcacatt
gacagagactgtcgttctgacccagcacagcaaaaacgcaagatcttcaccaataagtgt
gaacgttctggctgccggcagcgggagatgatgaaactgacttgtgatcgctgtggccga
aacttctgcatcaagcaccgtcatcccctggaccatgaatgctctggggaaggtcatcag
accagcagggcagggcttgctgctatttctagagcacaaggtctggcttctacaagcacc
gcccccagtccaagccggaccttgccttcatcatcctccccaagcagagctacaccccag
cttccaaccaggacagcctctcctgttattgctttgcagaatggcttgagtgaggatgag
gccctgcagcgtgccctggaactgtcccttgcggaggctaaaccccaggttctaagttct
caggaggaagacgacttggcgttagcacaggcactgtcagccagtgaggcagaataccaa
cagcagcaggcgcagagtcgtagcttgaagccgtccaactgcagcctgtgctag

DBGET integrated database retrieval system