KEGG   Mus musculus (mouse): 68832Help
Entry
68832             CDS       T01002                                 

Gene name
Ldah, 1110057K04Rik, mLDAH
Definition
(RefSeq) lipid droplet associated hydrolase
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LIDHydrolase Abhydrolase_1 Hydrolase_4 Ser_hydrolase Abhydrolase_6 PaO
Motif
Other DBs
NCBI-GeneID: 68832
NCBI-ProteinID: NP_765989
MGI: 1916082
Ensembl: ENSMUSG00000037669
UniProt: Q8BVA5 A0A0F6AIX5
Position
12; 12 A1.1
AA seq 326 aa AA seqDB search
MASEVEEQIPVREEFFLCGGVETKIIKCGPWTNLFEKQDVSKPKQLIFIIPGNPGYSAFY
VPFAKALYTLMKSRFPVWIISHAGFSVTPKDKKVLAAPQEESNAQKIEDVYGLNGQIEHK
IAFLRAHVPKDVKLILIGHSVGTYMTLHVMKRVPELPVAHAFLLFPTIERMSESPNGKFA
TPFLCQFRYLLYATSYLLFKPCPEVIKSFIIQKLMGQMNIKLELPLTDILQPFCLANAAY
LGSQEMVQIVKRDDDIIKEFLPKLKFYYGKTDGWCPVKYYEDMKKDFPEGNIYLCEKGIP
HAFVLDFSQEMATIVAEWINNRPPRK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagaagtcgaggaacaaatccctgtgcgtgaggagttctttctctgtggtgga
gttgaaaccaagatcataaaatgtgggccctggactaacctctttgagaaacaagacgtc
agcaagccaaaacagcttatcttcatcattcccggtaacccaggctattccgcattctac
gtgccatttgcaaaggccttgtacactttgatgaagagccgcttcccggtatggataatc
tctcatgctgggttttcggtgactcccaaagacaagaaggttcttgcagcaccacaggaa
gagtcaaatgctcaaaaaattgaggacgtctatggtctgaatggtcaaatagagcacaaa
atagcttttctgagagctcacgtgccaaaggatgtgaagcttatactcattggccattcc
gtaggcacctatatgacccttcacgtgatgaagcgagtccccgagctgcctgtcgcccac
gcctttctgctcttcccaactatcgaacgaatgtctgaatcgcccaacggcaagtttgcc
actccatttttgtgccagtttcgatacctgctctatgctaccagctacttactttttaag
ccgtgtcctgaagtcataaaatctttcataatccaaaagctcatgggacaaatgaacatt
aagcttgaacttcctttgacggatatccttcaaccattttgccttgctaacgctgcctac
ctcgggagccaagaaatggtccagatagtgaagcgagatgatgacatcataaaggagttt
ctccctaagcttaagttttactatggtaaaactgatggctggtgtccagtaaagtactat
gaagacatgaagaaagattttccagaaggcaatatttacctctgtgagaaaggaatacca
catgcttttgttctcgattttagccaggagatggctaccatagttgctgagtggataaat
aatagaccgcccagaaaatag

DBGET integrated database retrieval system