KEGG   Mus musculus (mouse): 68865Help
Entry
68865             CDS       T01002                                 

Gene name
Arv1, 1110067L22Rik, AI461928, AW121084
Definition
(RefSeq) ARV1 homolog, fatty acid homeostasis modulator
  KO
K21848  lipid intermediate transporter
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    68865 (Arv1)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    68865 (Arv1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arv1 ADD_ATRX
Motif
Other DBs
NCBI-GeneID: 68865
NCBI-ProteinID: NP_081131
MGI: 1916115
Ensembl: ENSMUSG00000031982
Vega: OTTMUSG00000061564
UniProt: Q9D0U9 Q0VBH5
Position
8; 8 E2
AA seq 266 aa AA seqDB search
MGTGGRRGTRSGKGTEGAAATSSSCLYRCIECNREAQELYRDYSHGVLKITICKSCQKPV
DKYIEYDPVIILINAILCKTQAYRHILFNTKINIHGKLCMFCLLCEAYLRWWQLQDSSQS
PAPDDVIRYAKEWDFYRMFVIASFEQAAFLTGIFAFLWVQQPMTAKRAPDFVLLLKALLL
SSYGKLLLIPAVIWEHDYTPLCLRLIKVFVLTSNFQAVRVTLNTNRRLSLLVVLSGLLLE
SIVVFFFQRMEWDVSSDCALYKSQDF
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggggaccggcgggcgtagggggacgcggtccgggaaaggcacggaaggcgcagcggcg
acttcttcctcttgcctgtatcgttgtatcgagtgcaaccgagaggctcaggagctgtac
cgggactacagccacggcgtgctcaagataaccatctgcaaatcctgccagaaaccagta
gacaaatacatcgaatacgaccctgttattatcttgattaatgccattttatgcaaaact
caggcctacaggcatattcttttcaacactaaaataaatatccatgggaaactctgcatg
ttttgtttgctttgtgaagcatacctgcggtggtggcagctgcaggactcgagccagagt
ccagcccccgatgacgtgatccggtacgccaaggagtgggacttctacaggatgtttgtg
atcgcttctttcgaacaagctgcctttcttactggcatatttgctttcctgtgggtacag
caacccatgacagcaaaaagagcacccgactttgttctgctgctgaaagcactgttgctg
tccagctacgggaagctcctgctaatcccggccgtcatctgggaacatgactacacacct
ctgtgtctcaggctcattaaagtgtttgtcctgacctcaaatttccaggcagtcagagtg
accctgaacacaaaccggaggctctccctgttggtcgtgctaagtggcttactgctggag
agcattgtggtcttcttcttccagaggatggagtgggatgtgagcagtgactgtgcgctc
tacaagtctcaggacttctga

DBGET integrated database retrieval system