KEGG   Mus musculus (mouse): 68867
Entry
68867             CDS       T01002                                 

Gene name
Rnf122, 1110063C11Rik
Definition
(RefSeq) ring finger protein 122
  KO
K15699  RING finger protein 122
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    68867 (Rnf122)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    68867 (Rnf122)
Motif
Pfam: zf-RING_2 zf-RING_11 zf-rbx1 zf-C3HC4 zf-C3HC4_2 zf-C3HC4_3 zf-RING_5 zf-RING_UBOX zf-ANAPC11 Prok-RING_4 Prok-RING_1 zf-C3H2C3
Other DBs
NCBI-GeneID: 68867
NCBI-ProteinID: NP_780345
MGI: 1916117
Ensembl: ENSMUSG00000039328
Vega: OTTMUSG00000027149
UniProt: Q8BP31 A0A0R4J0G8
Position
8; 8 A3
AA seq 154 aa
MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFI
SKLRNQAQSERYGYKEVVLKGDAKKLQLYGTCAVCLEDFKGKDELGVLPCQHAFHRKCLV
KWLEVRCVCPMCNKPIAGPTETSQSIGILLDELV
NT seq 465 nt   +upstreamnt  +downstreamnt
atgcacccattccagtggtgtaacgggtgtttctgtggcctgggactggttagtaccaac
aagtcctgctcaatgccaccgatcagtttccaagaccttcccctcaatatctacatggtc
atcttcggcacaggcatcttcgtcttcatgcttagcctcatcttctgctgctacttcatc
agcaaactccggaaccaggctcagagcgagcgatacggctacaaggaggtggtgcttaaa
ggtgatgctaagaagttacagctctatgggacctgtgcagtttgcctggaagacttcaag
gggaaggatgaactaggcgtgcttccatgccagcatgcctttcaccgcaagtgtctggtg
aagtggctagaagtacgttgtgtctgccccatgtgcaacaagcccatcgcgggccccacg
gagacctcgcagagcatcgggatcctgctggatgaactggtgtaa

DBGET integrated database retrieval system