KEGG   Mus musculus (house mouse): 68870
Entry
68870             CDS       T01002                                 
Symbol
Ak8, 1190002A17Rik, AK_8
Name
(RefSeq) adenylate kinase 8
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00230  Purine metabolism
mmu00730  Thiamine metabolism
mmu01100  Metabolic pathways
mmu01232  Nucleotide metabolism
mmu01240  Biosynthesis of cofactors
Module
mmu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    68870 (Ak8)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    68870 (Ak8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    68870 (Ak8)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     68870 (Ak8)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   68870 (Ak8)
SSDB
Motif
Pfam: ADK AAA_17 AAA_18 Hydin_ADK AAA_33 AAA RuvB_N SKI AAA_16 AAA_5 KTI12 DUF5582 PPV_E1_C SRPRB PMBR 6PF2K ABC_tran AAA_14 RNA_helicase AAA_28 TIP49 DUF5586
Other DBs
NCBI-GeneID: 68870
NCBI-ProteinID: NP_001029046
MGI: 1916120
Ensembl: ENSMUSG00000026807
UniProt: Q32M07
Position
2:28588287..28703177
AA seq 479 aa
MDATTAPHRIPPEMPQYGEDYYIFEMMQNMLEQLLIHQPEDPISFMITHLRRNNDNVPKV
VILGPPASGKTTIAMWLCKHLNSNLITKESLLEREFSRLSVEAKSYYQVYKKIPNSILVS
LVQERLNEDDCLRKGWILDGIPERREQALMIQTLGLAPKHVIVLNAPDTVLIERNVGKRI
DPVTGEIYHTTFDWPPEPEIQNRLRQPEGISEIETAKKLLEYHRHIIRILPSYPKILKTI
SSDQPCVDVFYQALTYVQSGHRCNAPFTPKVLLCGPLGSGKRLQATLLAQKYGLVNISCG
QLLKEAVAAKSSFGELIQPFFEKRMTVPDSIITKVLADRMEQQDCIQKGWVLHGFPRDLD
QARMLNSMGYNPNRVFFLSVPLDSILERLTLRRTDPVTGERFHLMYKPPPTIEVQVRLLQ
NPKDSEEYIKLQTDLFYRNSGDLEQYYDRAIIVNGDQDPYTVFEYIESGIINPLPRKVT
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggatgcaaccacagcccctcatcgcattcccccggaaatgcctcagtacggggaagac
tactacattttcgagatgatgcagaacatgttggagcagctcctgatccaccagccggag
gaccccatcagcttcatgatcactcacctgcgcaggaacaatgataatgtgccgaaggtt
gtgatattaggtccgcctgcctcagggaaaaccaccatcgccatgtggctctgcaaacat
ctaaacagcaacctcatcaccaaggagagcttactagaaagagagttttcccgtctgtct
gtggaagccaagagttactaccaggtttacaagaagattcccaattcgattcttgtcagt
cttgtccaggagcgtctgaatgaagatgactgcctcagaaagggctggatcctggacggc
atccctgagaggcgggagcaggctctgatgatccagaccctggggctggcgcccaagcac
gtcattgtgcttaatgctccagacactgtcctgatcgagagaaatgtgggcaagcggatc
gaccctgtcaccggagagatctatcacaccaccttcgactggccccctgagcctgaaata
cagaacaggctgagacagccggagggcatctcggagatcgaaacggcgaagaagctgctg
gagtaccacaggcacatcatcaggattcttccttcttacccaaaaatcctgaaaaccatc
agctcagaccagccgtgtgtggatgtcttctaccaggctctgacctatgtccaatctggc
catcgatgcaatgccccattcacccccaaggtgctgctgtgtgggccgttgggcagcggg
aagagactgcaggctacccttctggcccagaaatatggccttgtaaacatcagctgcggg
cagctgctgaaggaggctgtggcagccaagtcaagcttcggggagctcatccagccattc
tttgaaaagaggatgacagttccagacagtatcatcaccaaagttctggctgatcgaatg
gagcaacaagattgcatccagaaagggtgggtgctgcacggcttcccaagagacctggac
caggcccggatgctgaactccatgggctacaatcccaacagggtcttcttcctgagtgtg
ccactggattccattctggagcggctgacgctgagaaggacagaccctgtcacaggagaa
aggttccacctcatgtacaagccccctcccaccatagaggtccaggtccgcctcctgcag
aaccccaaggattcagaggagtacatcaagctccaaacggacctgttctacaggaactct
ggggatctggagcagtactacgatcgagccatcattgtcaacggagaccaggacccatac
acagtttttgagtatatagagagcgggatcattaatcctctgcccaggaaagttacctga

DBGET integrated database retrieval system