KEGG   Mus musculus (house mouse): 68876
Entry
68876             CDS       T01002                                 
Symbol
Atp23, 1110068E08Rik, 2410012H02Rik, Xrcc6bp1
Name
(RefSeq) ATP23 metallopeptidase and ATP synthase assembly factor homolog
  KO
K18156  mitochondrial inner membrane protease ATP23 [EC:3.4.24.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    68876 (Atp23)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    68876 (Atp23)
SSDB
Motif
Pfam: Peptidase_M76 Peptidase_M13
Other DBs
NCBI-GeneID: 68876
NCBI-ProteinID: NP_001153031
MGI: 1916984
Ensembl: ENSMUSG00000025436
UniProt: G3UW46
Position
10:complement(126703698..126737893)
AA seq 246 aa
MAGAPGGGELGPAAGEPLLQRPDSGQGSPEPPAHGKPQQGFLSSLFTRDQSCPLMLQKTL
DTNPYVKLLLDAMKHSGCAVNRGRHFSCEVCDGNVSGGFDASTSQIVLCENNIRNQAHMG
RVVTHELIHAFDHCRAHVHWFTNIRHLACSEIRAASLSGDCSLVNELFRLRFGLKQHHQT
CVRDRAVLSILAVRNVSREEAQKAVDEVFQTCFNDREPFGRIPHNQTYARYAHRDFQNRD
RYYSNI
NT seq 741 nt   +upstreamnt  +downstreamnt
atggcaggagctccgggcggcggcgagctcggccctgcggctggcgagccactgctgcag
cgacccgactctggccagggctcgcctgagccgccggcccacgggaagccccagcagggc
ttcctctccagcctcttcacccgggaccagagttgtccgctcatgctccagaagacgctg
gataccaatccatatgtcaaacttctacttgatgctatgaaacactcaggttgtgctgtg
aacaggggaagacacttttcctgcgaagtctgcgatggaaacgtcagcggaggctttgat
gcgtctacgtctcagattgttttgtgcgagaataacatccggaatcaggcgcacatgggc
agggtcgtcacccacgagctcattcacgcgtttgaccactgccgggctcacgtccactgg
ttcaccaacatcagacatctggcgtgctcggagattcgagccgcaagcctcagcggggac
tgctcccttgtgaacgaactcttcaggctgcgttttggattaaagcaacatcatcagact
tgcgtgcgggacagggctgttctctctatcttggctgtccggaacgtcagcagagaggag
gcccagaaggctgtggatgaagtcttccagacctgtttcaatgaccgggagcccttcggc
aggatcccacataaccagacgtatgccagatacgctcacagggactttcagaaccgggac
cgctactactccaacatatga

DBGET integrated database retrieval system