KEGG   Mus musculus (mouse): 68876
Entry
68876             CDS       T01002                                 

Gene name
Atp23, 1110068E08Rik, 2410012H02Rik, Xrcc6b, Xrcc6bp1
Definition
(RefSeq) ATP23 metallopeptidase and ATP synthase assembly factor homolog
  KO
K18156  mitochondrial inner membrane protease ATP23 [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    68876 (Atp23)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     68876 (Atp23)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    68876 (Atp23)
SSDB
Motif
Pfam: Peptidase_M76 Peptidase_M13
Other DBs
NCBI-GeneID: 68876
NCBI-ProteinID: NP_081134
MGI: 1916984
Ensembl: ENSMUSG00000025436
UniProt: Q9CWQ3
Position
10; 10 D3
AA seq 201 aa
MAGAPGGGELGPAAGEPLLQRPDSGQGSPEPPAHGKPQQGFLSSLFTRDQSCPLMLQKTL
DTNPYVKLLLDAMKHSGCAVNRGRHFSCEVCDGNVSGGFDASTSQIVLCENNIRNQAHMG
RVVTHELIHAFDHCRAHVHWFTNIRHLACSEIRAASLSGDCSLVNELFRLRFGLKQHHQI
ETSCVSRPAMNSQSCLGLVSA
NT seq 606 nt   +upstreamnt  +downstreamnt
atggcaggagctccgggcggcggcgagctcggccctgcggctggcgagccactgctgcag
cgacccgactctggccagggctcgcctgagccgccggcccacgggaagccccagcagggc
ttcctctccagcctcttcacccgggaccagagttgtccgctcatgctccagaagacgctg
gataccaatccatatgtcaaacttctacttgatgctatgaaacactcaggttgtgctgtg
aacaggggaagacacttttcctgcgaagtctgcgatggaaacgtcagcggaggctttgat
gcgtctacgtctcagattgttttgtgcgagaataacatccggaatcaggcgcacatgggc
agggtcgtcacccacgagctcattcacgcgtttgaccactgccgggctcacgtccactgg
ttcaccaacatcagacatctggcgtgctcggagattcgagccgcaagcctcagcggggac
tgctcccttgtgaacgaactcttcaggctgcgttttggattaaagcaacatcatcagata
gagactagctgtgtatccagacctgctatgaattcacaatcctgcctcggtctcgtgagt
gcgtag

DBGET integrated database retrieval system