KEGG   Mus musculus (mouse): 68911
Entry
68911             CDS       T01002                                 

Symbol
Pygo2, 1190004M21Rik, mpyg
Name
(RefSeq) pygopus 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: PHD Prok-RING_1 PHD_2 zf-RING_2 PHD_4
Other DBs
NCBI-GeneID: 68911
NCBI-ProteinID: NP_001280692
MGI: 1916161
Ensembl: ENSMUSG00000047824
Vega: OTTMUSG00000022069
UniProt: Q3V113
Position
3; 3 F1
AA seq 368 aa
MKSPEKKRRKSNTQGPAYSHLTEFAPPPTPMVDHLVASNPFEDDFGAPKVGGAGPPFLGS
PVPFGGFRVQGGMAGQVPPGYGTGGGGGPQPLRRQPPPFPPNPMGPAFNMPPQGPGYPPP
GNMNFPSQPFNQSLGQNFSPPGGQVMPGPVGGFGPMISPTMGQPPRGELGPPPLPQRFTQ
PGAPFGPSLQRPGQGLPSLPPNTSPFPGPDPGFPGPGGEDGGKPLNPPAPTAFPQEPHSG
SPAAAVNGNQPSFPPSSSGRGGGTPDANSLAPPGKAGGGSGPQPPPGLVYPCGACRSEVN
DDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCLKTKEIQSVYIREGMG
QLVAANDG
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgaagagccctgaaaagaagcgaagaaagtccaatactcagggtcctgcatattcacat
ctgacggagttcgccccacccccgacccccatggtggatcatctggtcgcttctaaccct
tttgaggatgatttcggagcccctaaagtggggggcgcaggccctccgttcctcggcagt
ccggtgccctttggaggctttcgtgtacaggggggcatggcaggccaggtacccccaggc
tacggcactggaggaggagggggtccccagccacttcgtcggcagccccctccttttccc
cccaaccctatgggtccagcttttaatatgccccctcagggccctggctacccgccccct
ggcaacatgaactttcccagtcaacccttcaaccagtctctgggccaaaactttagccca
cctggtgggcaggtgatgccaggcccagtaggcggatttggtcccatgatctcaccgacc
atgggacagcctcctagaggggagctgggtcctcctcctctcccccaacgctttacccaa
ccaggagcaccttttggtccttctcttcagagacctggtcagggactccccagcctgccc
cccaacacaagtcccttccctggtccagaccctggttttcctggccctggcggtgaggat
ggtgggaagcccttgaacccaccggctcccaccgcctttccccaggagccccattcgggc
tcccccgctgctgctgtcaatgggaatcagcccagtttcccccctagcagcagtggtcga
ggtgggggcactccagatgccaacagtctggcaccccccggcaaggcagggggaggctca
gggccccagcctcccccaggcctggtgtacccctgcggtgcctgccgtagtgaggtaaat
gatgaccaggatgccattctgtgtgaggcctcctgccagaagtggtttcaccgcgagtgc
accggcatgaccgagagtgcctacggcctgctgaccaccgaggcctctgccgtctgggcc
tgtgatctttgcctcaagaccaaggagatccagtctgtctacatccgagagggcatgggc
cagttggtggctgctaacgatgggtga

DBGET integrated database retrieval system