KEGG   Mus musculus (house mouse): 68918
Entry
68918             CDS       T01002                                 
Symbol
1190005I06Rik
Name
(RefSeq) RIKEN cDNA 1190005I06 gene
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DUF4597
Other DBs
NCBI-GeneID: 68918
NCBI-ProteinID: NP_932105
MGI: 1916168
Ensembl: ENSMUSG00000043687
UniProt: Q8K1L6
Position
8:complement(121335341..121361129)
AA seq 111 aa
MTPAAHGCKRVAWCPSRPPASAPSAPQEAARRGDAMGLKPSCLKGFKMCVSSSNNNHDEA
PVLNDKHLSVPNIIITPPTPTGMGLSRDSNKQVWMDELGSYQDDGELEPEA
NT seq 336 nt   +upstreamnt  +downstreamnt
atgacccccgcggcccacggctgcaagcgcgtcgcctggtgtccctcacggccgccagcg
tccgcgcccagcgcgccccaggaagcggcccgcagaggcgacgccatggggctgaagccc
tcctgtctgaaaggctttaagatgtgtgtcagcagcagcaacaacaaccacgacgaggcc
cccgtcctgaatgacaagcacctgagcgtgcccaacattatcatcacgcccccaaccccg
acgggcatggggctttcccgggattctaacaagcaagtctggatggatgagctggggtct
tatcaagacgatggagagctggaacctgaagcctga

DBGET integrated database retrieval system