KEGG   Mus musculus (mouse): 68925Help
Entry
68925             CDS       T01002                                 

Gene name
Rpap1, 1190005L06Rik, A730023M06Rik, AU041788, AW107702, mKIAA1403
Definition
(RefSeq) RNA polymerase II associated protein 1
  KO
K20826  RNA polymerase II-associated protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    68925 (Rpap1)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     68925 (Rpap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPAP1_C RPAP1_N
Motif
Other DBs
NCBI-GeneID: 68925
NCBI-ProteinID: NP_001157173
MGI: 1916175
Ensembl: ENSMUSG00000034032
Vega: OTTMUSG00000016529
UniProt: Q80TE0
Position
2; 2 E5
AA seq 1409 aa AA seqDB search
MMLSRPKPGESEVDLLRFQSQFLEAGAAPAVQLVKGSRRHGDAPPDRLPPQDHRDVVMLD
NLPDLPPALLPAPAKRARPSPGHPLPHDEDPEERLNRHDQHITAVLSKIVERDTSSVTVT
LPVPSGVAFPPVFHRSQERQVKPAASGKRSIFAQEIAARRVSGNRVTSAEQVVPSLDTPE
GAVPCETPSFRDRSNQLPGRSHGFHRPNLVTGKGLRSKVAEQEVQTIHEENVARLQAMDP
EEILKEQQQLLAQLDPSLVAFLRSHSQVQEQTGTKATKKQSPKRPSVLVTKEEPVTSTRT
REPRTGDKLEEKPEATVEDKMEDKLQPRTPALKLPMTPSKDWLHMDTVELDKLHWTQDLP
PLRRQQTQERMQARFSLQGELLAPDVDLPTHLGLHHHGEEAERAGYSLQELFHLTRSQVS
QQRALALQVLSQIVGRAQAGEFGDRLVGSVLRLLLDAGFLFLLRFSLDDRVDSVIAAAVR
ALRTLLVAPGDEELLDRTFSWYHGASVFPLMPSQDDKEDEDEDEELETEKVKRKTPEEGS
RPPPDLARHDVIKGLLATNLLPRLRYVLEVTCPGPSVILDILAVLIRLARHSLESAMRVL
ECPRLMETIVQEFLPTSWSPIGVGPTPSLYKVPCASAMKLLRVLASAGRNIAARLLSGFD
VRSRLCRFIAEAPHDLALPPEEAEILTTEAFRLWAVAASYGQGGDLYRELYPVLLRALQT
LPTELSAHPLQPLAMQRVAALFTLLTQLTLAASSIPPEPASGPAESCVPAIPSSVTWTQV
SGLKPLVEPCLKQTLKFLPRPDVWNALGPVPSACLLFLGAYYQAWSRQSHLCPEDWLQDM
ERLLDESLLPLLSQPPLGSLWDSLRDCSPLCNPLSCASNPEALPSLVSLGCAGGCPPLSV
AGSASPFPFLTALLSLINTLVQSHKGLCGQLSAVLTAPGLQNYFLQCVAPAPAPQLTPFS
AWALHHEYHLQYLVLSFAHKAATLQPEPAASTALHHAVALVLLSRLLPGSEYLAQELLLS
CVFRLEFLPESASGGPEAADFSDGLSLGSSGDPQCRRGALLVQACRDLPSIRSCYLAHCS
PARASLLSSQALYCGELLRVSSLLLPVPKEPLLATDWPFQPLIHLYHRASDTPSGPPAAD
TVGVAMRVLQWVLVLESWRPEVLWAVPPAARLARLMCVYLVDSELFRETPIQRLVAALLA
RLCRPQVLPNLKLDCPLPGLTSFPDLYASFLDHFEAVSFGDHLFGALVLLPLQRRFSVTL
RLALFGEHVGVLRALGLPLTQLPVPLECYTEPAEDSLPLLQLYFRALVTGTLRARWCPIL
YTVAVAHVNSFIFCQDPKSSDEVKTARRSMLQRTWLLTDEGLRQHLLHYKLPNSSLPEGF
ELYSQLPRLRQQCLQTLPTEGLQNGGVKT
NT seq 4230 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgtccagaccgaagcctggagagtcagaggtggacctgctgcgcttccagagc
cagttccttgaggctggtgcagccccggcggtgcagctggtgaaggggagtaggaggcat
ggtgatgctcctccagaccggctcccaccgcaggaccatcgggatgtggtgatgctggac
aatctcccagatttgcccccagctctgcttcccgctcctgcaaaaagagcaagaccgagc
cctggtcacccgctgcctcacgatgaagaccctgaagagaggctgaacaggcatgatcag
cacatcactgctgtcttgtctaagattgttgaacgagatacaagttcagtcactgtgact
ctgcctgtgcccagtggtgttgctttcccgcctgtgttccatcgctctcaggagagacag
gtgaaaccagcagcatctggtaaaaggagcatctttgcccaagagattgcagcaagaagg
gtgtcaggaaacagggtgacatcagctgagcaagttgtccccagcctagacacaccagag
ggtgctgtgccctgtgagacaccctccttcagggacagaagcaaccagcttcctgggagg
agtcatggcttccacagaccaaatctagtcacaggaaaggggctcaggagcaaggtggct
gagcaggaggtccagacaatccatgaagagaatgtagcaagactacaagccatggatcct
gaggagatcctgaaggagcagcagcagttactggctcaactcgaccccagcttggttgcc
ttcttgagatctcatagccaggtccaggaacaaacaggaacaaaggccaccaagaagcag
agtccaaagagaccctcagttcttgtcactaaagaagagcctgtcacgtcaactcgtaca
agggagcctaggactggggacaagctggaagaaaagccggaggccacggtggaggacaag
atggaagacaagctgcagccaagaaccccagcactgaaactgcccatgacccccagcaaa
gactggctccacatggacaccgtagagctggacaagctccactggacccaggacctgccc
ccactccggcggcagcagacacaggagagaatgcaggctcgattcagccttcagggcgag
ctcctggcgcctgatgtggatcttcccacacatctgggcctgcaccaccacggagaagag
gccgagcgagcagggtattctctacaggagctgttccacctgacccgtagccaggtgtcc
cagcagagagcactagcattgcaagtgttgtcccagatcgtcggcagggcccaggctggt
gagtttggggaccgcctagtgggcagtgtcttgcgcctcctcttggatgctggtttcctc
ttcctgctgcgcttctctctggatgacagggtggacagtgtcatcgcagcagctgtccgg
gctcttcgtactctgctagtggctcctggagatgaggagctcctggaccgcaccttctct
tggtatcatggagcttcggtgttccctctgatgcccagccaggacgataaagaggatgaa
gatgaagatgaggaactcgaaacagaaaaggtgaagagaaagacacctgaggaaggaagc
cgccctcccccggacctggccagacatgatgtcatcaaggggctcctggctaccaacctg
cttcctcggctccgctatgtgctggaggtgacctgcccaggaccctctgtgatccttgac
atcctggctgtgcttatccgcctggcccggcattccctggagtcggccatgagggtcctg
gagtgtcctcggctgatggagaccatagttcaagagttcctgcctaccagttggtcccct
ataggggtggggcctactcccagtctatataaagtgccttgtgcttctgccatgaaactg
cttagagtcctggcttcagctgggaggaatattgctgctcgactgctaagcggctttgat
gtcaggagccgcctgtgccgattcatagctgaagcgccacatgacctggccttgcccccc
gaggaagcagagattctgaccactgaggccttccgtctgtgggccgtggctgcctcctat
ggccagggtggtgacctttacagggagctgtacccagtgctgctgcgggccttgcagaca
ctgcctacagagctcagcgctcatcccctacagcccctggccatgcagcgggtggccgct
ctgttcacactgcttacccagctcaccctggcagctagcagcatacctcctgagcccgcc
agtggccctgctgagtcctgtgtgccggccatcccttcctcagtcacctggacacaggtg
tctggactcaagccactggtggagccatgtctaaagcagaccctaaagttcctgcccagg
ccggatgtgtggaatgccctgggcccagtgcccagtgcctgccttctgttcttgggtgct
tactatcaggcctggagccggcagtcacacttgtgcccagaagattggcttcaggacatg
gagcgcttgttggatgagtccttgctgccactgctgagccagcctcctctgggcagtctg
tgggattccttaagggactgctccccactctgcaatccgctgtcctgtgcttccaacccg
gaagccctccccagccttgtgtcactgggctgtgcaggaggctgtccccctctcagtgtg
gctggctcagcctcacccttcccgttcctcactgccctcctctccctcatcaacactctg
gtccagagccacaaggggctctgtggacagctgtctgctgtgttgactgccccaggactc
cagaactactttctccagtgtgtggctcctgcgcctgccccacagctcacacccttctct
gcctgggccctgcaccatgagtaccacctacagtatctggtgctttccttcgcccacaaa
gcggcaacactgcagccagaaccagctgccagcactgccctccaccatgctgtagccttg
gtcctgctgagccggctgttgcctggaagcgaataccttgcccaggagctgctgctgagc
tgtgtgttccggctggagttcctgccggaaagtgcttcagggggcccagaggcagctgac
ttctccgatggactgtccttagggagcagtggggaccctcagtgtagacgaggggccctc
ctcgttcaagcttgccgggatctccccagcatccgcagctgctacctggcccattgttca
ccagcccgagccagtctgctgagctcccaagccttgtactgtggagagctactgcgagtc
tcaagtctgctactgcctgtacctaaggagccactgctggccactgactggcccttccag
ccgttgatacatctctaccaccgagcttcagatactccctctgggccacctgctgctgac
actgtaggcgttgccatgcgggtcctacaatgggtgctagttctggagagctggcgcccc
gaggtcctctgggctgtgccccctgctgcccgcctagcacgtctcatgtgtgtgtacctg
gtggatagcgagctgtttcgagagactcccatacagcgactggtggcagctcttttagct
cggctctgtcggccccaagtcttgccaaacctcaagctggactgccccctccctggcctg
acctcttttcctgacctttatgccagcttcttagaccattttgaggctgtctcttttggg
gaccacttgtttggggccctggtcctccttcctctgcagcgtaggttcagtgttaccttg
cgcctcgccctctttggggagcacgtgggagtgttgcgagcacttggcctgcctctgact
cagctgcctgtgcctctggagtgctacacagagcctgctgaagacagcctgcctctcctt
cagctctacttccgggccttggttactggtacactccgtgcacgttggtgccccatcctc
tacactgtagccgtggctcatgtcaacagtttcatcttctgccaagacccaaagagctca
gatgaggtaaagactgcccgaaggagtatgctgcagagaacgtggctgctgacagatgag
gggctgcggcagcatctcctccactataagcttcccaactccagcctcccagagggcttt
gagctgtattcccagttacctcgcctgaggcagcagtgccttcagacactgcccacagag
gggctccagaatggaggagtcaagacatag

DBGET integrated database retrieval system