KEGG   Mus musculus (house mouse): 68952
Entry
68952             CDS       T01002                                 
Symbol
Tlcd3b, 1500016O10Rik, A330104J06Rik, Fam57b
Name
(RefSeq) TLC domain containing 3B
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 DUF3487
Other DBs
NCBI-GeneID: 68952
NCBI-ProteinID: NP_081160
MGI: 1916202
Ensembl: ENSMUSG00000058966
UniProt: Q7TNV1
Position
7:126413213..126429391
AA seq 275 aa
MALLFLLGCVFFPLCFVVLRWGLQNRTSLRMERQEAVLVASKLVSSVQAIMASTAGYIVS
TSCKHIIDDQHWLSSAYTQFAVPYFIYDIYAMFLCHWHKHQVKGHGGEDGTPRALGSTWA
VVRGYLHKEFLMVLHHAAMVLVCFPLSVVWRQGKGDFFLGCMLMAEVSTPFVCLGKILIQ
YKQQHTLLHKVNGALMLLSFLCCRVLLFPYLYWAYGRHAGLPLLSVPMAIPAHVNLGAAL
LLAPQLYWFFLICRGACRLFRPRGSPPPSPCQTQD
NT seq 828 nt   +upstreamnt  +downstreamnt
atggccctgctcttcctgctggggtgtgtcttcttcccactgtgctttgtggtattacgc
tgggggctgcagaatcgaaccagcttacggatggagaggcaagaggctgtcttggtggca
tccaagttggtgtcctctgtccaagccatcatggcctccacagctggctacatagtctcc
acttcctgcaagcacatcatagatgaccagcactggctgtcctcggcctatacacagttt
gcagttccctacttcatctatgacatctatgccatgttcctctgccactggcacaagcac
caggttaaagggcacggaggggaagacgggacgcccagagccctgggcagcacctgggct
gtggtacgcggctacctgcacaaggagttcctcatggtgctccaccacgcggccatggta
ctggtgtgcttcccactctcagtggtgtggcgacaaggcaagggagatttctttctaggc
tgcatgttgatggccgaggtcagcactcctttcgtctgcctgggcaagatcctcattcag
tacaagcagcagcacacgttgctgcacaaggtgaacggagccctgatgctactcagcttc
ctgtgctgccgggtgctgctcttcccctacctgtactgggcctacgggcgccacgctggc
ctgcccctgctctcagtgcccatggccatcccggcccacgtcaacctgggcgccgcactg
ctcctcgcaccccagctctactggttcttcctcatttgccgcggggcctgccgcctcttc
cgaccccgaggctccccaccaccctctccttgtcagacccaggactga

DBGET integrated database retrieval system