KEGG   Mus musculus (mouse): 68953Help
Entry
68953             CDS       T01002                                 

Gene name
Chmp2a, 1500016L11Rik, mVps2
Definition
(RefSeq) charged multivesicular body protein 2A
  KO
K12191  charged multivesicular body protein 2A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    68953 (Chmp2a)
  09143 Cell growth and death
   04217 Necroptosis
    68953 (Chmp2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    68953 (Chmp2a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    68953 (Chmp2a)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    68953 (Chmp2a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   68953 (Chmp2a)
  Exosomal proteins of other body fluids (saliva and urine)
   68953 (Chmp2a)
  Exosomal proteins of colorectal cancer cells
   68953 (Chmp2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 DUF2570 YlqD
Motif
Other DBs
NCBI-GeneID: 68953
NCBI-ProteinID: NP_081161
MGI: 1916203
Ensembl: ENSMUSG00000033916
Vega: OTTMUSG00000060980
UniProt: Q9DB34
Position
7 A1; 7
AA seq 222 aa AA seqDB search
MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVR
IMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLP
QIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELS
NLPSTGGSLSVAAGGKKAEATASALADADADLEERLKNLRRD
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggacctgttgtttgggcgccggaagacgccagaggaactacttcggcaaaaccagagg
gccctgaaccgagccatgagagaactggacagggaacgacagaaactagaaacccaggaa
aagaaaatcattgcggacatcaaaaagatggcaaagcaaggccagatggatgctgttcga
atcatggcaaaagacctggtgcgtacccggagatatgtacgcaagtttgtgttgatgcgg
gccaacatccaagctgtgtccctcaagatacagactctaaaatccaacaactcaatggca
caagccatgaagggtgttactaaggccatgggcactatgaacagacagctgaaattaccc
cagatccagaagatcatgatggagtttgaacggcaggcagagatcatggacatgaaggaa
gaaatgatgaatgacgcaattgatgatgccatgggtgatgaggaagatgaagaggagagt
gatgctgttgtgtcccaggtcctggatgagctgggactgagcctcacagatgagctgtca
aaccttccctccactggaggctcactcagtgtggcagctggtgggaagaaagcagaggcc
acagcctcagccctggctgatgctgatgcagacctggaagagaggctcaagaaccttcgc
agggactga

DBGET integrated database retrieval system